KEGG   Microbacterium sp. No. 7: AOA12_15400Help
Entry
AOA12_15400       CDS       T04102                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
mio  Microbacterium sp. No. 7
Pathway
mio00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mio00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AOA12_15400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mio01007]
    AOA12_15400
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mio03016]
    AOA12_15400
   03029 Mitochondrial biogenesis [BR:mio03029]
    AOA12_15400
Enzymes [BR:mio01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     AOA12_15400
Amino acid related enzymes [BR:mio01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   AOA12_15400
Transfer RNA biogenesis [BR:mio03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AOA12_15400
 Prokaryotic Type
   Other AARSs
    AOA12_15400
Mitochondrial biogenesis [BR:mio03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AOA12_15400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1 tRNA-synt_1g
Motif
Other DBs
NCBI-ProteinID: ALJ21211
UniProt: A0A0P0EHM7
Position
complement(3259368..3261029)
Genome map
AA seq 553 aa AA seqDB search
MNPDALSAALLTVIVPLAEARRPGAVEGLTAADLPLERPKNRDHGDWASNAALKLAKAVG
ANPRELAAEIATALEGVDGVASVEVAGPGFINIRLDAAAAGALARTIVEQGAAYGTNDTQ
RGATINLEFVSANPTGPMHIGHTRWAALGDAIARVLLASGATLVREFYINDAGAQMDRFG
RSVLASVKGEPTPEDGYPGSYIDDLGRRVLALQPDLLGLPDPETVARDLAYELQLGDLQA
SLEKFNVHFDVWFSERTLHARGEDGGPSLVDEAVDRLRAQGHVFDAEGAVWVRTTDFGDD
KDRVIRRSNGEYTYFAADAAYYLNKGDRGFAHKIYLLGADHHGYVHRLKALAGAAGDDPE
KDIEVLIGQLVSVNGARLSKRAGNIIELDDLRDWLGTDALRYSLARYPADSPLTLDPDVL
TKRTNDNPVFYVQYAHARTHNVARNAADSGVTRDAFAPELLTHETESALLGALQEFPRIV
AFAADVREPHRVARYLEELAGLYHRWYDNCRVTPLGDEEVTDLHRTRLWLNDATGQVLRN
GLDLLGVSAPERM
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgatgccctctccgccgcgctgctcaccgtcatcgtccccctcgccgaggcg
cgacgacccggagcggtggagggcctgacggccgccgacctgccgctcgagcggcccaag
aaccgcgatcacggcgactgggcgtcgaacgcggcgctcaagctcgcgaaggccgtcggc
gcgaacccgcgcgagctcgcggccgagatcgcgacggcgctcgagggcgtcgacggcgtc
gcgagcgtcgaggtcgcgggacccggcttcatcaacatccgcctggatgccgcggccgcc
ggcgcgctcgcgaggacgatcgtcgagcagggcgccgcgtacggcaccaacgacacgcag
cgcggcgccacgatcaacctcgagttcgtcagcgccaaccccacgggccccatgcacatc
ggccacacgcgctgggcggcgctgggcgacgcgatcgcgcgcgtgctgctcgcgagcggc
gcgacgctcgtgcgcgagttctacatcaacgacgcgggcgcgcagatggatcgcttcggg
cgctcggtgctggcatccgtcaagggcgagcccacgcccgaggacggctacccgggctcc
tacatcgacgacctcggccggcgcgtgctcgcactgcagcccgatctgctcgggctgccc
gatcccgagaccgtcgcgcgcgacctcgcgtacgagctccagctcggcgacctgcaggcc
tcgctggagaagttcaacgtgcacttcgacgtgtggttcagcgagcgcacgctgcacgcc
cgcggcgaggacggcggcccgagcctcgtcgacgaggcggtcgaccggctgcgcgcacag
gggcacgtcttcgacgccgaaggcgccgtgtgggtgcgcacgaccgacttcggcgacgac
aaggaccgcgtgatccgccgctccaacggcgagtacacctacttcgccgcggatgccgcg
tactacctgaacaagggcgaccgcgggttcgcgcacaagatctacctgctcggcgccgac
caccacggctacgtgcaccgcctcaaggcgctcgccggcgcggcgggcgacgaccccgag
aaggacatcgaggtgctcatcgggcagctcgtgtcggtcaacggcgcccgtctcagcaag
cgcgcgggcaacatcatcgagctcgacgacctgcgcgactggctcggcaccgacgccctg
cgctactcgcttgcgcgctaccccgccgactcgccgctcacgctcgaccccgacgtgctc
acgaagcgcacgaacgacaaccccgtgttctacgtgcagtacgcgcacgcccgcacccac
aacgtggcccgcaacgcggccgacagcggcgtgacgcgcgatgcgttcgcgcccgagctg
ctgacgcacgagaccgagtcggcgctgctgggcgcgctgcaggagttcccgcgcatcgtg
gccttcgccgccgacgtgcgcgagccgcaccgcgtcgcccgctacctcgaggagctcgcg
ggcctgtaccaccgctggtacgacaactgccgggtcaccccgctcggcgacgaggaggtc
accgacctgcatcgcacgcgcctgtggctcaacgacgccacgggtcaggtgctccgcaac
ggcctcgacctgctcggcgtcagcgcgcccgagcgcatgtga

DBGET integrated database retrieval system