KEGG   Microbacterium sp. No. 7: AOA12_18460Help
Entry
AOA12_18460       CDS       T04102                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mio  Microbacterium sp. No. 7
Pathway
mio00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AOA12_18460
Enzymes [BR:mio01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AOA12_18460
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AOA12_18460
    1.1.1.-  
     AOA12_18460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N adh_short ELFV_dehydrog TrkA_N ApbA ADH_N_assoc AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ALJ21767
UniProt: A0A0N7I4C9
Position
3942262..3943356
Genome map
AA seq 364 aa AA seqDB search
MPATTTFTPDSDTMRAAVMHGKGDIRIESVPVPSALPGELLLQVSAVGVCGTDAAEWANG
PKLFPIEVPHPVTGHVGPMIVGHEFAGTVVDVGEGVDPSWIGRLVASCGSMPCGECDECT
GGRSNLCRRYAAVGLHRDGALAAYVSAPLGSCVDVGVLGLGPDEAALAQPMAIAVHSMRR
ARLRPGDVAVVQGVGGIGAFLISALVDAGARVVAVDLSEERLGIARSLGADVTILAGTDE
ARQRIADEFTDRIPVFFEVTGSDPGLQLALDIVPMGTEIVMVGIHKAPRTIDLARVTVRE
LSLIGTNAMVRETDFPEAARLVAARRGQWGEIAPAPLPLDDLVDGALRPMSEGRPPAIKT
LIHP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgacaacgacattcacgcccgattccgacaccatgcgcgccgccgtcatgcat
ggcaagggcgacatccgcatcgagtcggtccccgtcccctccgcgctgcccggcgagctg
ctgctccaggtctcggcggtcggcgtgtgcggcaccgatgcggcggagtgggcgaacggc
ccgaagctcttccccatcgaggtgccgcatcccgtgacgggacacgtcggcccgatgatc
gtggggcacgagttcgccgggacggtcgtcgacgtgggcgagggcgtcgacccgtcgtgg
atcggcaggctcgtcgcgtcgtgcggctcgatgccgtgcggcgagtgcgacgaatgcacg
ggcggccgctcgaacctctgccgccggtacgcggcggtcggcctgcaccgcgacggcgcg
ctcgccgcctacgtgtcggcgccgctcggcagctgcgtcgacgtcggcgtcctgggcctc
ggcccggacgaggccgccctcgcgcagccgatggccatcgccgtgcactcgatgcgccgc
gcgcgcctccggccgggcgacgtcgccgtcgtgcagggcgtcggcggcatcggcgcgttc
ctcatcagcgcgctcgtcgacgccggcgcgcgcgtcgtcgccgtggatctgtccgaggag
cggctcggcatcgcccgctcgctcggcgcggacgtgacgatcctcgccgggaccgacgag
gcccggcagcggatcgcggacgagttcaccgaccgcatccccgtgttcttcgaggtgacc
ggctccgacccgggcctgcagctcgcgctggacatcgtgccgatgggcacggagatcgtg
atggtcggcatccacaaggcgccccgcacgatcgacctcgcgcgggtcaccgtccgcgag
ctcagcctcatcggcaccaacgcgatggtgcgcgagacggacttccccgaggcggcacgg
ctggtcgcggcgcgccgggggcagtggggcgagatcgcgccggcgcccctcccgctcgac
gatctcgtcgacggcgcgctgcggccgatgtcggagggtcggccgcccgcgatcaagacg
ctcatccatccgtga

DBGET integrated database retrieval system