KEGG   Microbacterium sp. PAMC 28756: AXH82_04700Help
Entry
AXH82_04700       CDS       T04312                                 

Definition
(GenBank) hypothetical protein
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
mip  Microbacterium sp. PAMC 28756
Pathway
mip00860  Porphyrin and chlorophyll metabolism
mip01100  Metabolic pathways
mip01110  Biosynthesis of secondary metabolites
mip01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mip00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AXH82_04700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mip01007]
    AXH82_04700
Enzymes [BR:mip01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     AXH82_04700
Amino acid related enzymes [BR:mip01007]
 Aminotransferase (transaminase)
  Class III
   AXH82_04700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AMG82763
Position
complement(955894..957216)
Genome map
AA seq 440 aa AA seqDB search
MTDRNDDLFSAARAVIPGGVNSPVRAYGSVGGTPRFLASARGATVTDAAGREYVDLVASW
GPALLGHAQPDVVAAVQEAATRGLSFGAPTEGEVELAALIADRVRFGEIRPVERVRLVST
GTEATMTAIRLARGATGRDLLVKFAGHYHGHSDGLLAEAGSGVATLALPGSAGVPAPIAA
QTLVIRYNDPEALAAVFAEHGPRIAAVIVEASAANMGVVPPLPGFNRLIAETAHAHGALM
ILDEVLTGFRVHPAGFWGLQAQAGEDYLPDILTFGKVVGGGMPLAALGGRAEVMDLLAPL
GPVYQAGTLSGNPLSVAAGLATLRLATPEVYATVDAAAARVSSALDRALAEAGVTHALAS
AGNLFSASFRASAPRDYAEAQAQESFRYAAFFHAMREHGVALPPSVFEAWFLTAAHGEDE
LQRIEEALPHAAQAAQTARP
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgcaatgacgaccttttctctgccgcccgtgcggtgatccccggcggggtg
aactctccggtgcgggcctacgggtcggtcggcgggacgccgcggttcctcgcctcggcg
cgcggcgccacagtgaccgacgccgcgggtcgcgagtacgtcgacctcgtcgcgtcctgg
ggtcccgcactgctcggacacgcgcagcccgacgtcgtcgccgccgtgcaggaggccgcc
acccgcgggctctccttcggcgctccgaccgagggggaggtcgagctcgccgcgctcatc
gccgaccgcgtccgcttcggcgagatccgtcccgtggagcgtgtccgtctcgtctcgacg
ggcaccgaggccaccatgaccgcgatccgcctcgcccgcggtgcgaccggccgcgatctg
ctcgtgaagttcgccggccactatcacggccactccgacggcctgctcgccgaggcgggc
tccggggtcgccacgctggcgcttcccggttcggccggcgtgcccgcgccgatcgccgcg
cagacgctcgtgatccgctacaacgaccccgaggcgctcgccgccgtcttcgccgagcac
ggtccccgcatcgcggccgtcatcgtggaggcctcggccgcgaacatgggcgtggtgccc
ccgctccccggattcaaccgcctcatcgcggagaccgcgcacgcccacggtgctctcatg
atcctcgacgaggtcctcaccggcttccgggtgcacccggccggcttctggggcctccag
gcgcaggccggagaggactacctgcccgacatcctgaccttcggcaaggtcgtcggcggc
ggtatgccgctggcggcgctcggtggccgtgccgaggtcatggacctcctggcgcccctc
ggccccgtctaccaggcggggacgctctccgggaacccgctgtccgtggccgcgggcctg
gccacgctccgcctcgcgacgccggaggtctacgcgaccgtcgacgccgcagccgctcgg
gtctcgtcggctctcgaccgcgcgctcgccgaggccggagtgacccacgccctcgcctcc
gccggcaacctcttcagcgcctcgttccgcgcctccgccccgcgcgactacgccgaggcg
caggcgcaggagtcgttccggtacgcggcgttcttccacgcgatgcgcgagcacggcgtc
gcgctgccgccgagcgtcttcgaggcctggttcctcaccgccgcgcacggcgaggacgag
ctccagcggatcgaggaagccctgccgcacgccgctcaggccgcccagaccgcgcgcccc
tga

DBGET integrated database retrieval system