KEGG   Microbacterium sp. PAMC 28756: AXH82_12350Help
Entry
AXH82_12350       CDS       T04312                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mip  Microbacterium sp. PAMC 28756
Pathway
mip00625  Chloroalkane and chloroalkene degradation
mip00680  Methane metabolism
mip01100  Metabolic pathways
mip01120  Microbial metabolism in diverse environments
mip01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mip00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    AXH82_12350
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AXH82_12350
Enzymes [BR:mip01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     AXH82_12350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C AlaDh_PNT_C TrkA_N HI0933_like FAD_oxidored FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AMG84101
Position
complement(2598896..2600056)
Genome map
AA seq 386 aa AA seqDB search
MRAVVYEGPHTVSVTDVPDARIERPTDVLVRITTTNICGSDLHMYEGRTSFETGRWFGHE
NLGEVIEVGEGVDKVKVGDYVALPFNVACGHCKNCERGFTNYCLTAQPVPEWAGAAYGFA
DMGPWAGGQAELLRVPWGDFNCLRLGEDAEEKQNDYVMLADIFPTGYHATELAHVKPGDQ
TVIYGAGPVGYMAAYSAILKGAGKVMVVDRHPDRLRTIEELGAIAIDDSAVDPVEAVNEM
TMGLGADNGCECVGYQAHDPSGTEDPTLTLNRLVRSVRFTGEIGVVGVFIPQDPGATDEL
AKQGKLAFDFGEFWFRGQKLGSGQCPVKKYNRRLRDLIAGGKATPSRVVSHDLPLEEAPQ
AYEHFDNRDDGWTKVVLHPDRTSTAA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagtagtgtacgaaggcccgcatacggtgagcgtcaccgatgtaccggatgcc
cgtatcgaacgccccaccgacgtgctcgtgcgcatcaccacgacgaacatctgcggttcg
gacctgcacatgtacgagggccggacgagtttcgagaccggccgatggttcggccatgag
aacctcggcgaggtcatcgaggtcggcgagggcgtcgacaaggtgaaggtcggcgactac
gtcgcgctgcccttcaacgtcgcctgcgggcactgcaagaactgcgagcgcgggttcacc
aactactgtctcaccgcgcagcccgtcccggagtgggcgggagccgcctacggcttcgcc
gacatggggccgtgggccggcggtcaggccgagctcctccgggtgccgtggggcgacttc
aactgtctccgcctgggagaggacgccgaggagaagcagaacgactacgtgatgctcgcg
gacatcttccccaccggctatcacgccacggagctcgcccacgtgaagcccggggaccag
accgtgatctacggcgcgggccccgtcggctacatggccgcctactccgcgatcctcaag
ggggccggaaaggtcatggtcgtggaccggcatcccgaccgcctgcgcacgatcgaggag
ctcggcgcgatcgccatcgacgactccgcggtggaccccgtcgaggcggtcaacgagatg
acgatgggcctgggcgccgataacggctgcgaatgcgtcggctatcaggcgcacgatccg
agcggcaccgaggacccgaccctcaccctgaaccggctcgtgaggtcggtccggttcacg
ggcgagatcggcgtcgtgggagtgttcatcccgcaggacccgggcgccacggatgagctg
gcgaagcagggcaagctcgccttcgacttcggggagttctggttccgcggccagaagctc
gggagcggtcagtgtccggtgaagaagtacaaccgacgactgcgcgacctgatcgccggc
ggcaaggcgacgccctcccgcgtggtcagccacgatctgcctctcgaagaggcaccgcag
gcgtacgagcacttcgacaatcgggacgacggctggacgaaggtcgtgctgcacccggat
cgcacttcgacggcggcgtga

DBGET integrated database retrieval system