KEGG   Microbacterium sp. PAMC 28756: AXH82_12360Help
Entry
AXH82_12360       CDS       T04312                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
mip  Microbacterium sp. PAMC 28756
Brite
KEGG Orthology (KO) [BR:mip00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AXH82_12360
Enzymes [BR:mip01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     AXH82_12360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AMG84102
Position
2600432..2601241
Genome map
AA seq 269 aa AA seqDB search
MSENTAVPVAVCQFAPTDSREANRERIAELATEAARLGAKLIVFPEYSSYFVDPMDERLA
ANAEGLDGEFVTGLIGLAAELAVVIVAGVTERASDEGRVRNSVVAVRGDGILAVYRKQHL
YDAFGQTESDWVEPGEIGEPAVFEVGGLRFGLMTCYDLRFPELSRLLAVAGADALVVPAE
WVRGPLKEQHWTTLLAARAIENTVFVIAADHPAPIGVGHSRIVDPQGVVRAGIGSEPGVA
LGVVDGAAIARVRATNPSLRARRYAVVPR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaacaccgccgtgcccgtcgccgtgtgccagttcgcccccacggattcccgc
gaggccaaccgggaacggatcgcggagctggcgacggaggccgcgcgcctcggggcgaag
ctgatcgtgttccccgagtactcgagctacttcgtcgacccgatggacgaacgcctcgcg
gcgaatgcggagggtctcgacggcgagttcgtgaccgggctgatcggtctggccgcggag
ctcgccgtcgtcatcgtcgcgggcgtcacggagagggcctcggacgaggggcgcgtgcgc
aacagcgtcgtcgccgtgcgcggcgacggcatcctcgcggtctaccggaagcagcacctc
tacgacgcgttcgggcagaccgagtcggactgggtggagccgggggagatcggcgagccc
gcggtgttcgaggtcggcggactgcgcttcgggctgatgacctgctacgacctgcggttc
cccgagctgtcgcggcttctcgcggtcgccggtgccgatgcgctcgtggtgcccgcggag
tgggtgcgcggaccgctcaaggagcagcactggaccaccctgctcgccgcgcgggccatc
gagaacacggtgttcgtgatcgccgccgaccacccggcgccgatcggcgtgggccactcg
cgcatcgtcgacccgcagggcgtcgtccgcgccggcatcggctccgagcccggagtggcc
ctcggcgtggtcgacggcgcggcgatcgcccgcgtccgtgcgaccaatccctcgctgcgg
gcccgccgctacgctgtggtgccgcgctga

DBGET integrated database retrieval system