KEGG   Microcystis sp. MC19: B5D77_19540Help
Entry
B5D77_19540       CDS       T05365                                 

Definition
(GenBank) bile acid beta-glucosidase
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
miq  Microcystis sp. MC19
Pathway
miq00511  Other glycan degradation
miq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:miq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    B5D77_19540
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    B5D77_19540
Enzymes [BR:miq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     B5D77_19540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N
Motif
Other DBs
NCBI-ProteinID: AVQ73220
UniProt: A0A2P1UJW7
Position
3877765..3880119
Genome map
AA seq 784 aa AA seqDB search
MLNLVSLPEIPAAAWKRPLGKGWEKPYSVRYASNLDDGPWHGMPLGGFGAGCIGRSPKGD
FNLWHLDGGEHSFNSLAACQFSIFEQTEDGSAQAYAMATESPTDGTLSRWSWYPAEKGTY
SALYPRSWYEYKDVFQTQLICEQFSPVWAHNYQESSYPIALFEWTAHNPTDKPITISIML
TWQNTIGWFTNAIKSPVVKVRDDGSPVYEYQSKWGESEGNYNQWIVDNFRVGCLMRRDYE
NPGEGDGQMAIATITNPSLEVFYRGKWNPAGDGGEVWDYFAMNGSLPDIEDETPAQKGEQ
TATAMAIRFTIRPGKTRKIPFILAWDLPVTEFAQGINYYRRYTDFFGRNGQNAWAMVRTA
LKHGDTWRENIINWQKPILERSDLADWFKMALFNELYLLTDGGTLWTAATEQDPIGQFGV
LECIDYRWYESLDVRLYGSFGLLMLWPRLEKAVMEAFARAIPSSDDTPRIIGYNQASAIR
KAKNATPHDLGAPNEHPWQKSNYTSYQDCNLWKDLGSDFVLLVYRDYLLTGAKDEDFLRE
CWPSIVLTLQYLKTFDLDNDGIPENSGAPDQTFDDWRLQGISAYCGGLWIAALEATLKIG
AILGEDTAIFAGWLQQSRAIYHQTLWNGEYYNLDSGSGSDVVMTDQLCGQFYARLLALPD
VVENQYTQSALSKIYQACFLKFHEGKFGAANGLKPDGTPENPEATHPLEVWVGINFGLVA
FLMQMGMEKQGWQITEAVVKQVYENGLQFRTPEAITSVGTFRACHYLRAMAIWAIYGVLT
EFQG
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatctcgtctcccttccagaaattcccgccgctgcttggaaacgtcctctgggc
aaaggttgggaaaaaccctacagcgtccgctacgccagcaatttagatgatggtccttgg
catgggatgcctctggggggatttggggccggttgcatcggacgttcccccaaaggtgac
tttaacctctggcatctggacggcggtgaacacagttttaatagccttgcggcctgtcaa
tttagcatttttgaacaaacagaagacggaagcgcccaagcctacgctatggcgacggaa
agcccgacggatggaacgttatcgcgctggtcgtggtatccagccgaaaagggaacatat
tctgccctttatccccgcagttggtacgagtacaaagatgtttttcagactcaattaatt
tgcgaacaattctcaccggtttgggcgcataattatcaagaaagtagttatcctattgcc
ctatttgaatggacggctcataatcccaccgataaaccgattactattagtattatgctg
acttggcaaaatacaatcggttggtttactaacgcaattaaatccccagtggttaaggtg
agagatgatggtagtcccgtctatgaatatcaatcaaaatggggggaaagtgagggtaat
tataatcaatggattgtcgataatttccgcgttggctgtctaatgcgtcgggattacgaa
aaccccggggaaggggatggacagatggcgattgccactatcactaatccgagtctagag
gtattttatcggggtaaatggaaccctgccggcgatgggggcgaagtttgggactatttc
gccatgaatggctctttaccggatattgaggacgaaacccccgcccaaaaaggggaacaa
acggccacggctatggcgattcgttttaccattcgtccggggaaaactcgcaaaattcct
tttattttagcttgggatttacccgttaccgaatttgcccaaggaattaactattatcgt
cgttatacggactttttcggtcgaaatggtcaaaatgcttgggcgatggtacgcacggct
ttaaaacacggcgatacatggcgagaaaatattattaactggcaaaaaccgatcctagaa
cgcagcgatctggccgattggtttaaaatggctttatttaacgaattatacctcctaact
gacggcggcactctctggacggccgccacggaacaggatccgatcggtcaattcggagtg
ttagaatgtattgattatcgttggtatgaaagtcttgatgtgcgtctctatggttccttt
gggttattgatgttatggccgcgcttagaaaaggccgtcatggaagcttttgccagggca
attcccagcagtgacgacactcctcgaattatcggttataaccaagctagtgccattcgt
aaggctaaaaatgccactccccacgatttaggcgcacccaatgaacatccttggcaaaag
agcaattacaccagttatcaagattgtaatctctggaaagatttaggcagtgattttgtt
ttattagtctatcgggattatttattaacgggggctaaagatgaggattttctgcgggaa
tgttggccgtcaattgttctgactttgcaatatttaaaaacttttgaccttgataacgat
ggcatccccgaaaattccggcgcaccagaccaaacctttgatgattggcgtttacaggga
attagtgcctattgtggtggtttgtggatagcagccctagaagcgacgcttaaaattggg
gcaattcttggagaagatacagcaatttttgctggttggttacagcaatctcgcgctatt
tatcatcagactctctggaatggagaatattataatttagatagtggcagtggttccgat
gtggtgatgactgaccaattatgcggtcaattttatgcccgtttattggctttaccggat
gtggtagaaaatcaatacacgcaatcagctttaagtaagatttatcaggcttgttttctc
aagtttcatgagggaaaatttggggcagcaaatgggttaaaacccgatggtactcccgaa
aatcccgaggcaactcatcccttggaagtttgggtaggaattaattttgggttggtggct
tttttgatgcaaatgggaatggaaaagcaaggatggcaaattacggaagcggtggtgaaa
caagtctatgaaaatggcctacaatttcgcaccccggaagcgattacatcggtgggaact
tttcgcgcttgtcattatttacgcgccatggctatctgggctatctatggggttttgacg
gaatttcagggataa

DBGET integrated database retrieval system