KEGG   Mycobacterium paraintracellulare: OCQ_05520Help
Entry
OCQ_05520         CDS       T01755                                 

Definition
(GenBank) 4-hydroxy-2-ketovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00360  Phenylalanine metabolism
mir00362  Benzoate degradation
mir00621  Dioxin degradation
mir00622  Xylene degradation
mir01100  Metabolic pathways
mir01120  Microbial metabolism in diverse environments
mir01220  Degradation of aromatic compounds
Module
mir_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mir00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    OCQ_05520
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCQ_05520
   00622 Xylene degradation
    OCQ_05520
   00621 Dioxin degradation
    OCQ_05520
Enzymes [BR:mir01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     OCQ_05520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AFC52065
UniProt: A0A1X2L006
Position
544692..545750
Genome map
AA seq 352 aa AA seqDB search
MTTDIFFNPVWDVRMTDTSLRDGSHHKRHQFTKDEVGAIVAALDAAGVPVIEVTHGDGLG
GSSFNYGFSKTPEQELIKLAAETAKEAKIAFLMLPGVGTKEDIKEAQNNGGSICRIATHC
TEADVSIQHFGLARELGLETVGFLMMSHTISPEKLAAQARIMADAGCQCVYVVDSAGALV
LEGVRDRVAALVAELGDDAQVGFHGHENLGLGVANSVEAVRAGAKQIDGSCRRFGAGAGN
APVEALIGVFDKIGVKTGIDFFDIADAAEEVVAPAMPAECLLDRNALIMGYSGVYSSFLK
HAIRQGERYGVPPHELLHRAGQRKLIGGQEDQLIDIALEIKRERESGAAAAR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgacatcttcttcaacccggtctgggacgtgcggatgacggacacgtcgctg
cgcgacggctcacaccacaagcgccaccagttcaccaaggacgaggtcggtgcgatcgtg
gccgccctggacgccgcgggtgtgcccgtcatcgaggtcacccacggcgacggactgggc
ggctcgagcttcaactacgggttctccaagacccccgagcaggagctgatcaagctcgcc
gccgagaccgccaaagaggccaagatcgccttcttgatgctgcccggcgtgggcaccaag
gaagacatcaaagaggcccagaacaacggcggctcgatctgccggatcgccacgcactgc
accgaggccgacgtctcgatccagcacttcggcctggcccgcgaactcggcctggaaacc
gtcggcttcttgatgatgagccacaccatttcgccggagaagctggccgcccaggcccgc
atcatggccgacgcgggctgccagtgcgtctacgtggtcgactcggccggggcgctggtc
ctcgagggcgtgcgcgaccgcgtcgccgcgctcgtcgccgaactcggtgacgacgcccag
gtcggcttccacgggcacgaaaacctcggactcggggtggcaaacagcgtcgaggccgtg
cgcgctggcgctaagcagatcgacggctcgtgccgccgcttcggggccggggcgggcaac
gcccccgtcgaggcgctgatcggggtgttcgacaagatcggcgtcaagaccggcatcgac
ttcttcgacatcgccgacgccgccgaggaggtcgtcgccccagccatgcccgccgagtgc
ctgctcgaccgcaacgccctgatcatgggctactccggggtgtactccagcttcctcaag
cacgccatccgccagggtgagcgctatggcgtcccgccgcatgagctgttgcaccgggcc
ggccagcgcaagctcatcggcggccaggaggaccaactgatcgacatcgcgctggagatc
aagcgcgagcgagaaagcggcgccgccgccgcgcgctga

DBGET integrated database retrieval system