KEGG   Mycobacterium paraintracellulare: OCQ_09570Help
Entry
OCQ_09570         CDS       T01755                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00071  Fatty acid degradation
mir00072  Synthesis and degradation of ketone bodies
mir00280  Valine, leucine and isoleucine degradation
mir00310  Lysine degradation
mir00362  Benzoate degradation
mir00380  Tryptophan metabolism
mir00620  Pyruvate metabolism
mir00630  Glyoxylate and dicarboxylate metabolism
mir00640  Propanoate metabolism
mir00650  Butanoate metabolism
mir00900  Terpenoid backbone biosynthesis
mir01100  Metabolic pathways
mir01110  Biosynthesis of secondary metabolites
mir01120  Microbial metabolism in diverse environments
mir01130  Biosynthesis of antibiotics
mir01200  Carbon metabolism
mir01212  Fatty acid metabolism
mir02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCQ_09570
   00630 Glyoxylate and dicarboxylate metabolism
    OCQ_09570
   00640 Propanoate metabolism
    OCQ_09570
   00650 Butanoate metabolism
    OCQ_09570
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OCQ_09570
   00072 Synthesis and degradation of ketone bodies
    OCQ_09570
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCQ_09570
   00310 Lysine degradation
    OCQ_09570
   00380 Tryptophan metabolism
    OCQ_09570
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OCQ_09570
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCQ_09570
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OCQ_09570
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mir04147]
    OCQ_09570
Enzymes [BR:mir01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OCQ_09570
Exosome [BR:mir04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCQ_09570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AFC52470
UniProt: A0A1X2L2T1
Position
947694..949220
Genome map
AA seq 508 aa AA seqDB search
MNLDPNTPVIVGVGQFTERIEDSGYRGMSSVELATAAAQAALHDTGADVTAVATAIDTVA
ALRQFEISGRTPAPMGKSNNYPRSVAQRIGAAPARAILEPIGGQGPQHLVTEFAGVIASG
EAEVVMIFGSENTSSIRYFADRDKPDHSDTVEGSLEDRGFGYDGLFDDYTVAHGLIGAPA
QYGLLENARRGRLGLSVADYRREMGELFAPFTKVAAKNPFASSPVERSVDELITVTESNR
MICDPYPRLLVARDQVNQGAAALLMSVGAARRLGVPEERWVFLHGHADMVDQPLLDRLDL
TYNSASVLAVQEALAVAGVGIDDVSTFDLYSCFPVPVFNFCDGTQLATDDPRGLTLTGGL
PYFGGPGNNYSLHGIAETVSEMRDLPGQFGLVAANGGIMSKYSAGVYSTTPVNWKPDNSA
ALRAEVAARPKMAVTIKADGRATIETYTVRYDWPVRTGLIIGRLDDDGSRFLALSEDPDL
VGLLSDGEPLGASIVVRSTDKDNRATLA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgacccgaacacgcccgtcatcgtcggcgtggggcagttcaccgagcgcatc
gaggactccggctaccgcggaatgtcgtcggtggagttggcgacggcagcggcgcaggcc
gcgctacatgacaccggggccgacgtcaccgccgtcgccacggccatcgacaccgtcgcc
gccctccggcagttcgagatctccgggcgcacccccgcgccgatgggcaagtccaacaac
tacccgcggtcggtggcccagcgcatcggcgccgcgccggcccgcgcgatcctcgagccc
atcggcggccagggcccccagcatctggtcaccgagttcgccggtgtcatcgcctcgggg
gaggcggaggtcgtgatgatcttcggctccgaaaacacgtccagcatccggtatttcgcc
gaccgggataagccggatcattccgacacggtcgagggttccctcgaggaccgcgggttc
ggatacgacggcctgttcgacgactacaccgtcgcgcatgggctcatcggagcgccggcc
cagtacgggctgctggagaacgcgcgccgcggccggctgggcttgagcgtcgccgactac
cggcgcgaaatgggcgagctgttcgccccgttcaccaaggtggcggcgaagaacccgttc
gcgtcctccccggtggagcgcagcgtcgacgagctgatcaccgtcaccgagtccaaccgg
atgatctgcgatccgtacccgcggctgctggtggcccgcgatcaggtcaatcagggcgcg
gccgcgttgctgatgtcggtgggcgccgcccgccggctcggtgtgcccgaggagcgctgg
gtgtttctgcacggccacgccgacatggtggaccagccactgctggaccgcctcgacctg
acctacaactcggcctcggtgctggcggtccaggaagcgctcgccgtggccggtgtcggc
atcgacgacgtctcgaccttcgacctctacagctgcttcccggtgccggtgttcaacttc
tgcgacgggactcagctggccaccgacgatccgcgggggctcacactcaccggcggcctg
ccgtacttcggtggaccgggcaacaactactcactgcacggcatcgccgaaacggtcagc
gaaatgcgggatctgccagggcaattcggcctggtcgccgccaacggcgggatcatgagc
aagtactccgctggggtgtactcgaccacgccggtgaattggaagcccgacaacagcgcc
gcactgcgcgccgaggtcgcggcccgccccaagatggcggtgaccatcaaggccgacggt
cgcgcgaccatcgagacctacaccgtgcgctacgactggccggtgcgcaccggcctcatc
atcggccgcctcgacgacgacggcagccgcttcctggccctgagcgaggaccccgatctg
gtcgggttactcagcgacggcgagccgctgggggcttcgatcgtggtgcggtcgacggat
aaggacaaccgggccacgctggcctga

DBGET integrated database retrieval system