KEGG   Mycobacterium paraintracellulare: OCQ_09610Help
Entry
OCQ_09610         CDS       T01755                                 

Definition
(GenBank) phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00230  Purine metabolism
mir00670  One carbon pool by folate
mir01100  Metabolic pathways
mir01110  Biosynthesis of secondary metabolites
mir01130  Biosynthesis of antibiotics
Module
mir_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    OCQ_09610
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    OCQ_09610
Enzymes [BR:mir01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     OCQ_09610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N
Motif
Other DBs
NCBI-ProteinID: AFC52474
Position
953026..953610
Genome map
AA seq 194 aa AA seqDB search
MVLASGTGSLLNSLIAAAVADYPARIVAVGADRDCLATEIAAAASLPTFTVRLGDHPNRD
AWDAAITEATAAHSPDLVVSAGFMKILGPQFLSRFYGRVINTHPALLPAFPGAHGVADAL
AYGVKITGCTVHLVDAGTDTGPILAQQSVPVLDGDNEETLHERIKVTERKLLADVVAAIA
TGGLTLVGRKATIG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
gtggtactggcctcgggcaccggatcgctgctgaactccctgatcgccgccgccgtcgcg
gactatcctgcccggatcgtcgccgtcggcgccgaccgcgactgcctggccaccgagatc
gccgcggccgcgtccctgcccacctttaccgtccggctcggcgaccaccccaaccgcgac
gcctgggacgccgctatcaccgaggccaccgccgctcactcgcccgacctggtggtgtcc
gcgggattcatgaaaatccttggaccacagttcctttcacggttctacggacgcgtcatc
aacacgcatccggcgctgctgccggcgttcccgggcgcgcatggggtggccgacgcgttg
gcctacggcgtgaaaatcacaggctgtacggtgcacctggtggacgccgggacggacacc
gggccgatcctggcgcagcaatccgttcccgtgctcgacggcgacaacgaagagactttg
catgaacgcatcaaggtcaccgaacgcaagctgctcgcggacgtggtggccgcgatcgca
accggcgggctgaccctggtcgggagaaaagcgacgatcggatga

DBGET integrated database retrieval system