KEGG   Mycobacterium paraintracellulare: OCQ_09640Help
Entry
OCQ_09640         CDS       T01755                                 

Definition
(GenBank) hypothetical protein
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00860  Porphyrin and chlorophyll metabolism
mir01100  Metabolic pathways
mir01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OCQ_09640
Enzymes [BR:mir01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     OCQ_09640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase Sigma54_activat AAA_5 AAA_3 AAA_PrkA MCM ABC_tran AAA_16 NACHT
Motif
Other DBs
NCBI-ProteinID: AFC52477
UniProt: A0A1X2L2L3
Position
956010..957404
Genome map
AA seq 464 aa AA seqDB search
MVTSPSNLPRTVGELRAAGHRERGVKQEIRENLLTALADGPDSAAIWPGILGFDDTVLPQ
LERALIAGHDFVLLGERGQGKTRLLRALVGLLDEWTPVIAGAELGEHPFSPITPESIRKA
ATLGDDLPVEWKHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPR
AHRGIVAVNELPDLAERIQVSMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGR
IITPLKDRFGAEIRTHYPLELDAEVGVIAQEAHLSAQVPDYLMQIIARFARYLRESNSVD
QRSGVSARFAIAAAETVAAAARHRGAILGETDPVARVVDLGTVIDVLRGKLEFESGEEGR
EQAVLEHLLRRATADTASRVLGGIDVGSLVSAVEGGSAVTTGERVSAKDVLAAVPSLPVV
DKIADKLGARSEGERAAALELALEALYLAKRIDKVSEEGQTVYG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggtgacgtcaccgagcaacctgccccgcaccgtcggcgaactgcgcgccgccggtcac
cgtgaacggggagtcaagcaggaaatccgcgaaaatctgctgaccgcactggccgacggg
ccggacagcgcagccatctggcctggcattctgggattcgacgacaccgtcttgccccag
ctcgagcgggctttgatcgcgggtcacgacttcgtgctgctcggcgagcgcggccagggc
aaaacccggctgctgcgtgcgctggtcgggttgctcgatgagtggacgccggtgatcgcg
ggggccgaactgggggagcatccgttctcgccgatcacgccggagtcgatccgcaaggcc
gccaccctgggcgacgacctgccggtggagtggaagcaccgcagcgagcgctacaccgaa
aagctcgccacgcccgacaccagcgtcgccgacctggtgggcgacatcgacccgatcaag
gtcgccgagggccgcagcctgggggaccccgagaccatcgcctacgggctgattccgcgc
gcgcaccgcggcatcgtcgcggtcaacgaactccccgacctcgccgagcgcatccaggtg
tcgatgctcaacgtgatggaggagcgcgacatccaggtccgcggctacacgctgcgcctg
ccgctcgacgtgttggtggtcgccagcgccaaccccgaggactacaccaaccgcgggcgc
atcatcaccccgctcaaggaccgcttcggcgcggagatccggacccactatccgctcgag
ctcgacgcggaagtcggggtgatcgcgcaggaggcgcacctgtcggcgcaggtgcccgac
tacctcatgcagatcatcgcccggttcgcccgctacctgcgggagtcgaattccgtcgac
caacgctcgggggtgtcggcgcggttcgccatcgccgccgccgagaccgtcgcggccgcc
gcccgccatcgcggcgcgatcctgggggagacggacccggtggcacgggtggtcgatctg
ggcaccgtgatcgacgtcctgcgcggcaagctggaattcgagtccggcgaggaaggccgc
gagcaggcggtgctcgaacacctgctgcgccgggcgaccgcggacacggcgtcgcgggtg
ctcggcggcatcgacgtcggttcgctggtgtccgcggtcgagggcggttccgcggtgacg
acgggcgagcgggtgtcggcaaaggacgtgctggccgccgtcccgagcctgccggtggtg
gacaagatcgcggacaagctgggcgcgcggtcggagggcgaacgcgccgccgcgctcgag
ctggcgctcgaggctttgtatctggccaagcgcatcgacaaggtgtccgaggaggggcaa
accgtctatggctaa

DBGET integrated database retrieval system