KEGG   Mycobacterium paraintracellulare: OCQ_12550Help
Entry
OCQ_12550         CDS       T01755                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00300  Lysine biosynthesis
mir01100  Metabolic pathways
mir01120  Microbial metabolism in diverse environments
mir01230  Biosynthesis of amino acids
Module
mir_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    OCQ_12550
Enzymes [BR:mir01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     OCQ_12550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Cyclase
Motif
Other DBs
NCBI-ProteinID: AFC52767
Position
1271603..1272790
Genome map
AA seq 395 aa AA seqDB search
MLMVATRCARLRRACDRHWVLMVATRCARLRRACDRHYPETVLDLRGDPIALTAALVDIP
SESRNEARLADEVEAALRAQTSGFEVVRNGNAVLARTRHQRPSRVLLAGHLDTVPVAGNL
PSRHEGGELHGCGTADMKSGDAVFLHLAATVAEPVHDLTVVMYDCEEIDAAANGLGRIER
ELPDWLAADVAILGEPTGGYIEAGCQGTLRVVVSAAGTRAHSARSWLGDNAIHKLGAVLE
RLAAYEARSVDIDGCTYREGLSAVRIDGGVAGNVIPDAAAVTVNFRFAPDRSVPDALQHV
HDVLAGLDVHIEQTDAAAGAMPGLSQPAAKALVEAAGGNVRAKYGWTDVARFAALGIPAV
NFGPGDPNLAHRRDERVAVANITAAVDMLRRYLGG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgttgatggtggcgacccgctgcgcccggctccgccgcgcttgcgatcgccactgggtg
ttgatggtggcgacccgctgcgcccggctccgccgcgcttgcgatcgccactaccctgag
accgtgctggacttacgcggggatccgatcgcgctgaccgcggcgctggtcgacatcccc
agcgaatcgaggaacgaggcgcgcctggccgacgaggtcgaggcagcgctgcgcgcgcag
acctccggcttcgaggtcgtccgcaacggcaacgccgtgttggcgcgaacccgacaccag
cggccgtcgcgggtgctgctggccggccacctggacaccgtcccggtggccggaaacctg
cccagccgtcacgagggcggcgagctgcacggctgcggcaccgccgacatgaaatccggg
gacgccgtgttcctccatctcgccgccaccgtcgccgaacccgtgcacgatctgacggtg
gtgatgtacgactgcgaggaaatcgacgcggcggcaaacggtttgggccgcatcgaacgg
gaactgccggactggctggccgccgacgtggccatcctgggcgaaccgacgggcggctac
atcgaagccggttgccagggcaccctgcgcgtggtcgtcagcgccgccgggacccgcgcc
cactcggcgcgatcctggttgggggacaacgctattcacaaactgggtgccgtgctcgaa
cggctggccgcgtacgaggcacgcagcgtggacatcgatggctgcacgtaccgcgagggc
ttgtcggccgtgcgcatcgacggcggggtggcgggcaacgtcattcccgatgctgccgcg
gtgacggtcaacttccgctttgccccggaccggtcggtgcccgacgcgctgcaacacgtg
cacgacgtgctcgccggactggacgtgcacatcgaacagaccgacgccgcggccggggcg
atgcccgggctgtcccagcccgccgccaaggcgttggtcgaggcggcgggcggtaacgtg
cgggccaagtacggctggaccgacgtcgcgcggttcgccgcgctgggtataccggcggtc
aacttcggccccggcgacccgaatttggcgcaccggcgcgacgaacgcgtggcggtcgcc
aacatcaccgcggcggtggacatgctgcgccgctacctgggcggctag

DBGET integrated database retrieval system