KEGG   Mycobacterium paraintracellulare: OCQ_30820Help
Entry
OCQ_30820         CDS       T01755                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00260  Glycine, serine and threonine metabolism
mir00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mir01100  Metabolic pathways
mir01110  Biosynthesis of secondary metabolites
mir01130  Biosynthesis of antibiotics
mir01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OCQ_30820
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCQ_30820
Enzymes [BR:mir01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OCQ_30820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: AFC54594
UniProt: A0A1X2L0Q4
Position
complement(3274361..3275176)
Genome map
AA seq 271 aa AA seqDB search
MTVKQSEASRLGPIFDVCRDDGRAALIGYLPTGYPDVTTSVHAMVALVESGCDIVEVGVP
YSDPGMDGPTIAKATEAALHGGVRVRDTLAAVEAIGAAGGHAVVMTYWNPVLRYGIDAFA
RDLASAGGYGLITPDLIPDEAGQWLAASEEHRLDRIFLVAPSSTPQRLAMTVEASRGFVY
AASTMGVTGARDVVSNAAPELVGRVKEISDIPVGVGLGVRSGEQAAQIGGYADGVIVGSA
LVSALGDGGLTALRALTEELAAGVRQRAAAS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaagcagagcgaggccagcaggctcgggccgatcttcgacgtgtgccgcgac
gacggtcgcgccgcgctgatcggctatctgccgaccgggtacccggatgtgacgacgtcc
gtgcacgcgatggtcgccctggtcgaatccggttgcgacatcgtcgaggtcggggtgccc
tattcggatcccggcatggacggcccgaccatcgccaaggccaccgaggccgcgctgcac
gggggagtgcgcgtccgcgacaccctggccgcggtcgaggcgatcggcgccgccgggggc
cacgccgtggtgatgacctactggaaccccgtgttgcgctacggaattgacgccttcgcc
cgcgacctggcatcggccggcggatacggcctgatcactccggaccttatccccgacgaa
gccgggcagtggttggcggcgtccgaggagcatcggttggaccggatatttctggtggcg
ccctcctcgacgccgcagcgcttggcgatgacggtcgaggcgtcccgcggatttgtctac
gcggcgtcgacgatgggcgtcacgggagcacgcgacgtggtgtccaatgccgcgcccgaa
ttggtgggcagggtcaaggagatatcggacatccccgtcggtgtcgggctgggggtgcgg
tcgggtgagcaagccgcccagatcggcggctacgccgacggtgtcattgtcggttccgcg
ctggtgtcggcgctgggggacgggggtttgaccgcattgcgcgcactcactgaggaactc
gccgccggtgtacgtcaaagggcggccgcgtcgtga

DBGET integrated database retrieval system