KEGG   Mycobacterium paraintracellulare: OCQ_36380Help
Entry
OCQ_36380         CDS       T01755                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00071  Fatty acid degradation
mir00280  Valine, leucine and isoleucine degradation
mir00281  Geraniol degradation
mir00310  Lysine degradation
mir00360  Phenylalanine metabolism
mir00362  Benzoate degradation
mir00380  Tryptophan metabolism
mir00410  beta-Alanine metabolism
mir00627  Aminobenzoate degradation
mir00640  Propanoate metabolism
mir00650  Butanoate metabolism
mir00903  Limonene and pinene degradation
mir00930  Caprolactam degradation
mir01100  Metabolic pathways
mir01110  Biosynthesis of secondary metabolites
mir01120  Microbial metabolism in diverse environments
mir01130  Biosynthesis of antibiotics
mir01212  Fatty acid metabolism
Module
mir_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    OCQ_36380
   00650 Butanoate metabolism
    OCQ_36380
  Lipid metabolism
   00071 Fatty acid degradation
    OCQ_36380
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCQ_36380
   00310 Lysine degradation
    OCQ_36380
   00360 Phenylalanine metabolism
    OCQ_36380
   00380 Tryptophan metabolism
    OCQ_36380
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OCQ_36380
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OCQ_36380
   00281 Geraniol degradation
    OCQ_36380
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCQ_36380
   00627 Aminobenzoate degradation
    OCQ_36380
   00930 Caprolactam degradation
    OCQ_36380
Enzymes [BR:mir01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     OCQ_36380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFC55150
UniProt: A0A1X2KZT5
Position
3873129..3873878
Genome map
AA seq 249 aa AA seqDB search
MTDEILLIDTEERVRTLTLNRPQSRNALSSALRDRFFGALADAETDDDVDVVIVTGADPV
FCAGLDLKELGGSSALPDISPRWPAMTKPVIGAINGAAVTGGLELALYCDILIASENARF
ADTHARVGLLPTWGLSVRLPQKVGIGLARRMSMTGDYLSAADALRAGLVTEAVPHERLLG
AARQVAASIVGNNQDAVRALLASYHRIDDAQTGAGLWQEAMAARQFRTSGDDIAANREAV
LQRGRAQVR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgagatcctgctgatcgacaccgaggaacgggtccgcaccctgaccctgaac
cgaccccaatcgcgcaacgcgctgtcctcggcgttgcgggaccgcttcttcggcgcgctg
gccgacgccgaaaccgacgacgacgtcgacgtcgtcatcgtcaccggcgccgacccggtg
ttctgcgcgggactcgatctcaaggagctcggcggctcgtcggcgctgccggacatctcg
ccgcggtggccggcgatgaccaagccggtgatcggcgccatcaacggcgccgccgtgacc
ggcgggctggagctggcgctgtactgcgacatcctgatcgcctcggagaacgcccgcttc
gccgacacgcatgcccgggtgggcctgctgcccacctgggggctgagcgtgcggttaccg
cagaaggtgggcatcggcctggcccggcggatgagcatgaccggcgactacctgtccgcc
gccgacgcgctgcgcgccggcctggtgaccgaggcggtgccccacgagcggctgctgggt
gccgcgcgccaggtcgccgcgtcgatcgtggggaacaaccaggacgcggtgcgggcgctg
ctggcgtcctatcaccgcatcgacgacgcgcagaccggcgcggggctctggcaggaggcg
atggcggcccggcaattccggaccagcggcgacgacatcgccgccaaccgcgaggccgtg
ctgcaacgcgggcgggcccaggttcgctga

DBGET integrated database retrieval system