KEGG   Mycobacterium paraintracellulare: OCQ_47710Help
Entry
OCQ_47710         CDS       T01755                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00430  Taurine and hypotaurine metabolism
mir00620  Pyruvate metabolism
mir00640  Propanoate metabolism
mir00680  Methane metabolism
mir01100  Metabolic pathways
mir01120  Microbial metabolism in diverse environments
mir01200  Carbon metabolism
Module
mir_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:mir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCQ_47710
   00640 Propanoate metabolism
    OCQ_47710
  09102 Energy metabolism
   00680 Methane metabolism
    OCQ_47710
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    OCQ_47710
Enzymes [BR:mir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     OCQ_47710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AFC56283
Position
complement(4995583..4996722)
Genome map
AA seq 379 aa AA seqDB search
MLVINSGSSSVKFQLVDPDSGTALSTGLVERIGEEGSPVPDHDAALRRAFDTLADDGIDL
KTCGVVAVGHRVVHGGNAFYEPTPLDDAVIARLGELSDLAPLHNPPSLKGIEVARRLLPD
IPHIAVFDTGFFHDLPPAAATYAIDRDLAQRHQIRRYGFHGTSHRYVSEQAAAFLDRPPG
DLKQIVLHLGNGCSASAIAGTRPIDTSMGLTPLEGLVMGTRSGDIDPSVVSYLSHTAGMG
VDDVETMLNKRSGVLGLSGERDFRRLRRMIESGDESAQLAYSVFTHRLRKYVGAYLAVLG
HTDVISFTAGIGENDAAVRRDAVAGMEELGIVLDERRNLGGGKGARQISADDSPIAVLVI
PTNEELAIARDCVNVLAGS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtgatcaactccggctcgtcgtcggtgaagtttcagctggtcgatcccgattcg
ggcacggcgctctcgaccggcctcgtggaacgcatcggcgaggaggggtctcccgtcccc
gaccatgacgccgcgctgcgccgcgcgttcgacacgctggccgacgacggcatcgacctc
aagacatgcggcgtcgtcgcggtcggccatcgagtggtgcacggcggcaacgccttctac
gagcccaccccgctggacgacgcggtgatcgcccggctcggcgaactgtcggacctggcg
ccgctgcacaaccctccctcgctcaagggaatcgaggtcgcccggcggctgctgcccgac
attccgcacatcgcggtcttcgacaccgggttcttccacgacctgccgcccgctgccgcg
acctacgccatcgaccgcgacctggcgcagcggcatcagatccgccggtacgggtttcac
ggcacctcgcaccgctacgtcagcgagcaggccgccgccttcctggacaggccgcccggc
gacctgaaacagattgtgctgcacctgggtaacggctgctcggcctcggcgatcgccggc
acccggccgatcgacacctcgatgggcctcacaccgctggaggggctggtgatgggcacc
cgcagcggggacatcgatcccagcgtcgtcagctacctgtcccacaccgccgggatgggc
gtcgacgacgtcgagaccatgctcaacaagcgatccggggtgctgggcctgtccggtgag
cgcgacttccgccggctgcgaaggatgatcgaatccggtgacgagtcagcgcaattggcc
tatagcgtgttcacgcatcggctgcgcaagtacgtcggcgcctacctggcggtgctgggg
cacaccgacgtcatcagctttaccgcggggatcggcgagaacgacgcggcggtgcgccgc
gacgcggtcgcgggcatggaggagctgggcatcgtgctcgacgagcgccgcaacctcggt
ggcggcaagggtgcgcggcagatctccgccgacgattcgccgatcgccgtcctggtgatc
ccgaccaacgaagagctcgccatcgcccgcgactgcgtaaacgtgctggcgggctcctag

DBGET integrated database retrieval system