KEGG   Micromonas commoda: MICPUN_101378Help
Entry
MICPUN_101378     CDS       T02695                                 

Definition
(RefSeq) predicted protein
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
mis  Micromonas commoda
Brite
KEGG Orthology (KO) [BR:mis00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mis04131]
    MICPUN_101378
Enzymes [BR:mis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     MICPUN_101378
Membrane trafficking [BR:mis04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    MICPUN_101378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHHC LigA
Motif
Other DBs
NCBI-GeneID: 8245151
NCBI-ProteinID: XP_002503509
JGI: MicpuN3_101378
UniProt: C1E9Z5
Position
7:382486..385752
Genome map
AA seq 1088 aa AA seqDB search
MMNSATGGANGLPALPPRNGVRGGPSSRSAKNESSNGRAINNEPASTTADVESGEKEAKE
INLEEMHDKARTYFSLMADDVNGPIYNGGAMHGHGHGAPGANKGPTIPDVVTRFQAVTQR
FPALRKLIAKSTALQELLATPGALRKFLLAATNGGRGVDAMILAGGQRGGEDWRDIVERA
GTNSWEELQAMVEARDEMEMFAKGPTWTPGSAPLPPEPDEFESQQYLAEAAGESKMERSV
MTTYFSAYGQNSDVLAPFIIFGVGAFMAMYAPVYLWLPAWFAVIGLALQAARASAQLPGS
RQGPKNLFGAAMVHALIVYCGLQFALVYVPAQWSTHAGWCVVGLVSFITTPALLIRTYYL
GPGFVPLATDGRDQWVGNMRRVSRAAVAEKALKREREASSAAGVAASEADTRKYEHDFAV
TFPQEVVDDLVNSGKFCNTCHSARPLRSKHCPVCNRCVHRMDHHCPIAGTCIGVRNQRHF
LGGLWDMFVGQCVFVWFSYLHLAATYEAGGVAMRDTTLEGDSVSTVSTGGPVTKTFHVLR
HAPWAVILYVIQCFCAIYCLVLAGRMTLAVIANLTVNEMENSHRYEHFHSEDGTKFFNRF
DRGWHNNCIEFWRGHQERIDWDAMKIAVDRGDAAPPPRGSYSWFQNSRAPRWLKRACQIA
KPPGIGSKATRGGGGGHGHSHGGVPCEHGHGAPGPDTSSPAIFAAGNLTKGLPAAAAAAA
AAAAAADHAHHGHGHSHGGVSCDGDHGGGDPLPVSGAATAVAAAAAAAAAGPAAAVGTVV
AAAAAASNASDAHRGHSHAHGEGAGHSHGGSAEVSGGIQKSPEDGSGLPESAPPASLEEL
QAEAKAAMAAAMAKQAEHHGCTVEELERRGEEQKKRMFEMQAQSRGMTVEEFQKMAEDQM
AQRMKQMADANGITVEEVKARQELQQAAMMQQQLRLAEMRKQHFQNGAGEGDGEGGEEAR
EEERDPLKDLTDDEVKAKAEAALDEVMAAQGKMMGKTMEEMKKQNDFMKEQQKAQMAKMN
GLSVEQMEEMQDKQLAQMAKQNGMSVDRMKHVMMLQQAQQAQMRIAMMARMNQEGGQPGH
GPGHGHSH
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atgatgaactcggcgacaggcggcgcgaacggcctgcccgcgcttcctccgcggaacggc
gtcaggggcgggccgtcgtcgcgatcggccaagaatgaatcgtcgaacggcagggcaatc
aacaacgaacccgcttcaacgactgcggacgtggagagcggcgagaaggaggcgaaggag
atcaacctggaggagatgcacgacaaggcgaggacgtacttctccctcatggctgacgac
gtgaacgggccgatctacaacggcggcgccatgcacgggcacggacacggcgcgcccggc
gccaacaaaggcccgaccatccccgacgtcgtcacgcgcttccaggcggtcacgcaaagg
ttccccgccctccgcaagctcatcgccaaatccaccgcgttacaggagctcctcgccacc
ccgggtgcgctgcgaaagttcctcctcgcggcgacgaacgggggcaggggcgtcgacgcc
atgatcctcgccggcggccagcggggaggagaggattggcgcgacatcgtcgagcgagcg
ggaaccaactcgtgggaggagctccaagcgatggtggaggctcgcgatgagatggagatg
ttcgcgaaggggcccacgtggacgccgggcagcgccccgctcccgccggagcccgacgag
tttgaatcgcaacaatacctcgcggaggctgccggcgagagcaagatggagcgatcggtg
atgaccacctacttcagcgcgtacggccagaactccgatgtcttggccccgttcatcata
ttcggcgtcggggcgttcatggcgatgtacgccccggtgtatctctggctgcccgcgtgg
ttcgcggtcatcggtctcgcgttgcaggcggcgagggccagcgctcaactgccgggatct
cggcagggaccgaagaacctcttcggcgccgcgatggtccacgcgctgatcgtgtactgc
ggccttcagttcgcgctcgtgtacgtgccggcgcagtggtcgacgcacgcgggttggtgc
gtcgtcggcctggtctcgttcatcaccacccccgcgcttctcatccgcacgtattacctg
ggacccgggttcgtgcccctcgccaccgacgggcgggatcagtgggtcgggaacatgcga
cgcgtctcccgcgcggcggtggcggagaaggcgttgaagagggagagggaggcgtcgtcc
gccgcgggcgtcgccgcgtcggaggcggacacgcgcaagtacgaacacgactttgcggtg
acgtttccgcaggaggttgtcgacgacctcgtcaactctggcaagttttgtaacacgtgc
cacagcgctcggccgctgcgttcgaagcactgtcccgtgtgcaacaggtgcgtgcatcgc
atggatcatcactgcccgatcgcgggcacgtgcatcggcgtgaggaaccagaggcacttt
ctcggcggcttgtgggacatgttcgtcgggcagtgcgtctttgtgtggttttcgtacctg
cacctcgcggctacgtacgaagcgggcggagtcgccatgagggacaccacgctcgagggt
gactcggtatccacggtgtccacgggcggtccggtgacgaaaaccttccacgtcctgagg
cacgcgccgtgggcggtcatactgtacgtcatccagtgcttctgcgcgatttactgcctg
gtgctcgcgggccggatgacgctggcggtgattgccaacctcaccgtcaacgagatggaa
aactcccaccggtacgagcacttccactcggaggacggcaccaaattcttcaacaggttc
gaccgagggtggcacaacaactgcatcgagttttggcgcgggcaccaggagcggatagac
tgggacgccatgaagatcgccgtcgacaggggagacgccgctccaccgccgaggggttcg
tactcttggttccaaaactcgcgcgcgccgcgctggctgaagcgcgcgtgtcagatcgcc
aagccgccgggtatcgggtccaaggccacccggggaggaggaggaggccacgggcactcc
cacgggggcgtaccgtgcgagcacggccacggcgcccccggacccgacacatcttcgcca
gccatcttcgccgccggcaacctcaccaagggcctacccgccgccgccgccgccgccgcc
gccgccgccgccgccgccgatcacgcgcaccacggccacggtcactcgcacgggggcgtc
tcctgcgacggcgaccacggcggaggcgacccgcttccagtttcgggcgcggcgacggcg
gttgccgcggcggcggcggcggcggcggcggggcccgcggcggctgtcggaaccgtcgtc
gccgccgccgccgccgcgtcgaacgcctccgacgcccaccgcggccactctcacgcccat
ggcgagggcgcggggcattcgcacggcggatctgcggaggtatctggaggtatccagaag
tctccggaggatgggtccggactacccgagagcgcgccgcccgcgtctctcgaggagctt
caggcggaggccaaggcggcgatggccgccgcgatggccaagcaggctgagcaccacgga
tgcaccgtggaggagctcgagcgccgcggtgaggagcagaagaagcgcatgttcgagatg
caggcccagtcgcggggtatgacggttgaggagtttcagaagatggccgaggaccagatg
gcgcagaggatgaagcagatggcggacgccaacgggatcacggtcgaggaggtgaaggcg
cgccaggagctgcagcaggctgcgatgatgcagcagcagctcaggctcgcggagatgcgc
aagcagcactttcagaacggtgcgggggaaggagacggcgaggggggcgaggaggcgcgg
gaggaggagcgggatccgctgaaagatttgacggacgacgaggtcaaggccaaggctgag
gctgcgctggacgaggtcatggccgcgcagggtaagatgatgggcaagacgatggaggag
atgaagaagcagaacgacttcatgaaggagcagcagaaggctcagatggccaagatgaac
gggctgtccgtcgagcagatggaggagatgcaggataagcaactcgctcagatggcgaag
cagaacgggatgagcgtggaccggatgaagcacgtgatgatgctgcaacaggcgcagcag
gcgcagatgaggatcgcgatgatggcgaggatgaaccaggagggggggcagcccggacac
gggccaggccacggacactcgcactag

DBGET integrated database retrieval system