KEGG   Micromonas commoda: MICPUN_104787Help
Entry
MICPUN_104787     CDS       T02695                                 

Gene name
RBCS.1
Definition
(RefSeq) ribulose bisphosphate carboxylase small chain 1, chloroplast
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mis  Micromonas commoda
Pathway
mis00630  Glyoxylate and dicarboxylate metabolism
mis00710  Carbon fixation in photosynthetic organisms
mis01100  Metabolic pathways
mis01110  Biosynthesis of secondary metabolites
mis01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MICPUN_104787 (RBCS.1)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MICPUN_104787 (RBCS.1)
Enzymes [BR:mis01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MICPUN_104787 (RBCS.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 8242377
NCBI-ProteinID: XP_002500762
JGI: MicpuN3_104787
UniProt: C1E330
Position
3:join(1721656..1721765,1722303..1722732)
Genome map
AA seq 179 aa AA seqDB search
MAAISAVAPVLNKAPVVSTGKAANTNSMMVWQPHGNKFFETFSFLPPLSDQEVARQVQYL
LNNGWTPCIEFESAAKAYADTHGWSGLDSSVTAGYYDNRYWVMWKLPMYGCTNPDEVLQE
IRACTQAFPECFIRVAGFDNIKQVQCSSFLAHRPTGDRTFAPVTGRQVGGARQQSSGGW
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggccgctatctccgctgttgcccccgtcctcaacaaggcccccgtggtctccaccggc
aaggccgccaacaccaactccatgatggtgtggcagccccacggcaacaagttcttcgag
actttctccttcctcccccccctctccgaccaggaggtcgcccgccaggtccagtacctc
ctcaacaacggctggaccccctgcattgagttcgagtctgccgccaaggcctacgccgac
acccacggctggtccggcctcgactcctccgtcaccgcgggctactacgacaaccgctac
tgggtcatgtggaagctccccatgtacggctgcaccaaccccgatgaggtcctccaggag
atccgcgcgtgcacccaggccttccccgagtgcttcatccgcgtcgccggtttcgacaac
atcaagcaggtgcagtgctcctccttccttgcccaccgccccaccggtgaccgcaccttc
gcgcccgtcaccggccgccaggtcggtggtgcccgccagcagtcctccggcggctggtaa

DBGET integrated database retrieval system