KEGG   Micromonas commoda: MICPUN_107831
Entry
MICPUN_107831     CDS       T02695                                 

Definition
(RefSeq) predicted protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mis  Micromonas commoda
Pathway
mis00100  Steroid biosynthesis
mis01100  Metabolic pathways
mis01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mis00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    MICPUN_107831
Enzymes [BR:mis01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     MICPUN_107831
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 8241058
NCBI-ProteinID: XP_002499864
JGI: MicpuN3_107831
UniProt: C1DZI3
Position
2:complement(82711..84018)
AA seq 435 aa
MVATRRQTKKANPHYEFGGPIGALGIVLGLPAVCYGLVLTCNERHCVSLDYDSIAGIPSL
TLPSGTVLFSPEACAVFLGWMAWCVVLHLILPGVEKQGVKLANGKRLTYKLNGMSVFVVT
LGVVAHGVHQGWLDLGWVHDNFLALLTAGVAFAYAMSLALYLNSFGKGEEKGGKKLLAKG
GDTGNPLYDFFIGRELNPRVGSFDLKVFCELVPGLIGWLLLDLGFAHKQYATTGAVSPAM
ALVCAFQALYVADALWFEPAILTTMDVTTDGFGFMLVFGDLVWVPFTYSLQARYVLERPV
ALTPAFLALILCVKALGYAIFRGSNLQKNWFRNDPNDPRVAHLTYLPTKRGTRLITSGWW
GIARHVNYLGDWLMAWAWCLPCGFAHLVPYFYVIYFGILLVHRDMRDGEACQEKYGKDWD
KYCAVVKYRLIPYVY
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggtggcgacgcgcaggcagacgaagaaggctaacccgcactacgagttcggcggcccc
atcggggcgctgggcatcgtgctcggcctccccgcggtgtgctacggcctcgtgttgacg
tgcaacgagcgacactgcgtgtcccttgattacgactccatcgcggggatcccgtccctc
acgctcccctcgggcaccgtcctgttcagcccggaggcgtgcgcggtgttcctcggttgg
atggcgtggtgcgtcgtccttcatctgatactcccgggcgtcgagaaacagggcgtcaag
ctggccaacggcaagaggctgacctacaagctcaacgggatgagcgtgttcgtcgtcacc
ctgggcgtcgtggcgcacggggtgcaccaggggtggctcgatctcggctgggtgcacgac
aacttcctcgcgctcctcaccgcgggcgtggcattcgcctacgccatgtccctcgcgctc
tatctcaactccttcggtaagggcgaggagaagggcgggaagaagctcctcgccaagggg
ggcgacacgggcaacccgttgtacgatttcttcatcggccgcgagctcaacccgcgcgtc
ggctccttcgacctgaaggtgttctgcgagctcgtgccgggtctcatcggctggctcctg
ctggacctcgggttcgcgcacaagcagtacgcgacgacgggcgccgtgtcccccgccatg
gccctcgtgtgcgcgtttcaggccttatacgtggctgacgcgctctggttcgagcccgcc
atcctgaccaccatggacgtcaccaccgacgggttcgggttcatgctggtgttcggcgac
ctcgtgtgggtgccgttcacgtactcgctgcaggcgaggtacgtcctggagcgtcccgtg
gcgttgacccctgcgtttttagcgctcatcctctgcgtcaaggctctcggttacgccatc
ttccgcgggagcaacctccagaagaactggttccgaaacgacccgaacgacccgagggtg
gcgcacctgacgtacctgcccacgaagcggggcaccaggctgatcaccagcgggtggtgg
ggcatcgcgcggcacgtcaactacctgggcgactggctcatggcgtgggcctggtgcctg
ccgtgcgggttcgctcacctcgtgccttacttttacgtcatctacttcggcatcctgctc
gtgcacagggacatgcgggacggcgaggcgtgccaggagaagtacgggaaggactgggac
aagtactgcgccgtcgtcaagtacaggctgatcccttacgtgtattag

DBGET integrated database retrieval system