KEGG   Micromonas commoda: MICPUN_109115Help
Entry
MICPUN_109115     CDS       T02695                                 

Definition
(RefSeq) predicted protein
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
mis  Micromonas commoda
Brite
KEGG Orthology (KO) [BR:mis00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MICPUN_109115
Enzymes [BR:mis01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     MICPUN_109115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: peroxidase
Motif
Other DBs
NCBI-GeneID: 8247243
NCBI-ProteinID: XP_002505127
JGI: MicpuN3_109115
UniProt: C1EDL6
Position
11:complement(170319..171404)
Genome map
AA seq 361 aa AA seqDB search
MFSTVAAKPTTFASSARRSAVSKRRAKLAACPRASAEEIPAESVVTRSDQVSLTRRDALL
AALAVPLVMRDAPAFAETKKRAGAAGAAPKTPEESFASLRSDVEALMKKDGDFGPTMVRL
AWHSSGTYDKMSKTGGSGGGTIRFKEELAHGGNAGLDKAVARLEPVKRKHPEISYADLFA
YVGVVAIETMGGPKLKFSYGRVDEMDPAAVTPDGRLPNADVGDGPGPKERDHLRAIFNRM
GFNDQEIVALSGAHALGRCHADASGYVGPWSGTPLLFNNSYFVLLKGLKWAPNDEAAKFQ
YKDPSGQLMMLPSDIALIEDAKFKKYVDVYAKDQKKFFADFAAAFEKLESLGTSGLTPLS
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgttctccaccgtcgcggccaagcccacgactttcgcgtcctccgccaggcgctccgcg
gtctccaagcgccgcgccaagctcgccgcgtgcccccgcgcatccgccgaggagatcccg
gcggaatcggttgttacccgatccgatcaggtctcgttgacgcgccgcgacgcgcttctc
gccgcgctcgcggtgccgctcgtcatgcgcgatgcccccgccttcgccgagacaaagaag
cgcgcgggcgccgcgggcgccgcccccaagacccccgaggaatccttcgcgtccctccgg
tccgacgtcgaggcgctcatgaaaaaggatggcgatttcggccccacgatggtgagactc
gcgtggcactcctcggggacgtacgacaagatgtccaagaccggcggcagcggcggcggc
accatccgcttcaaggaggagctcgcgcacggcggcaacgcgggcctcgacaaggcggtc
gcgcgcctcgagcccgtcaagagaaagcatcctgaaatctcctacgccgatctcttcgcg
tacgtcggcgtcgtcgccatcgagacgatgggcggtcccaagctcaagttctcctacgga
cgcgtggacgagatggacccggccgcggtcacccccgacggaaggctcccaaacgccgac
gtcggcgacggaccgggcccaaaagagcgcgaccacctccgcgccatcttcaaccgcatg
ggattcaacgaccaggagattgtcgcgctctcgggcgcgcacgcgctcggtcgatgccac
gccgacgcctccgggtacgtcggcccgtggtccggaaccccgctgctcttcaacaacagc
tacttcgtcctgctcaagggtttgaagtgggcgcccaacgacgaggcggccaagttccag
tacaaggatcccagcggccagctcatgatgctgccgagcgacatcgcgctcatcgaggat
gccaagtttaagaagtacgtggacgtgtacgccaaggaccagaagaagttcttcgcggac
tttgcggcagcgttcgagaagctggagagcctcggaaccagcggactcaccccgctcagc
gcgtga

DBGET integrated database retrieval system