KEGG   Micromonas commoda: MICPUN_112646Help
Entry
MICPUN_112646     CDS       T02695                                 

Gene name
RAD51A
Definition
(RefSeq) Rad51 DNA recombinase 1
  KO
K04482  DNA repair protein RAD51
Organism
mis  Micromonas commoda
Pathway
mis03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mis00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    MICPUN_112646 (RAD51A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mis04131]
    MICPUN_112646 (RAD51A)
   04121 Ubiquitin system [BR:mis04121]
    MICPUN_112646 (RAD51A)
   03400 DNA repair and recombination proteins [BR:mis03400]
    MICPUN_112646 (RAD51A)
Membrane trafficking [BR:mis04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    MICPUN_112646 (RAD51A)
Ubiquitin system [BR:mis04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    MICPUN_112646 (RAD51A)
DNA repair and recombination proteins [BR:mis03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     MICPUN_112646 (RAD51A)
    RecA family proteins
     MICPUN_112646 (RAD51A)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     MICPUN_112646 (RAD51A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rad51 RecA ATPase AAA_25 HHH_5 DnaB_C AAA_22 AAA_24 RNA_pol_A_CTD PAXNEB
Motif
Other DBs
NCBI-GeneID: 8243079
NCBI-ProteinID: XP_002501408
JGI: MicpuN3_112646
UniProt: C1E452
Position
4:join(891136..891234,891360..891504,891587..892377)
Genome map
AA seq 344 aa AA seqDB search
MADLAMEAPVEGDMQEWEEGMAAAGPLPLQTLEEHGVAASDIKKLLEAGIHTVEGLAYAS
KKHLKDIKGLSEMKVEKLKMAATKVVPLGFTTASMVQAVRQDTIMVTTGASKLDELLGGG
FESGSLTEIYGEFRTGKTQLCHTLAVTCQLPLDQGGAEGKAMYIDTEGTFRPQRLIAIAE
RFGMDPNAVLDNVAYAKAHNTEHQSELLVAAAGMMAEARFGVIIVDSVTNLFRTEYEGRG
ELSARQMHLGKFLRHLTRLADEFGVAVVVTNQVVANPDGNAMFAGANALKPIGGNIMAHA
STTRIALRKGRGENRIAKIACSPVLPESEAQFSISELGIEDAKD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggctgacctcgcaatggaggcccccgtggagggggacatgcaggagtgggaggaaggg
atggcagctgccggccctctccctctccagactttggaggaacacggtgtcgcggcgtcc
gatatcaagaagctcctcgaggctggcattcacaccgtcgagggtctcgcgtacgcgtcg
aagaagcacctcaaggacatcaaggggctcagcgagatgaaggttgaaaagctcaagatg
gccgccaccaaggtggttcccctgggcttcaccacagcatcgatggttcaggctgtccgg
caggacacaatcatggtgacgacgggcgcgtcgaagctggatgagcttctgggtgggggt
ttcgagtctggatctcttacggagatttacggagagttcaggacgggcaagacgcagctg
tgccacacgctcgcggtgacgtgccagctcccgctcgaccagggaggcgctgagggtaag
gccatgtacatcgacacggagggcacgttcaggccgcagaggctcatcgccatcgccgag
cgcttcgggatggaccccaacgcggtgctggacaacgtggcgtacgccaaggctcacaac
acggagcaccagtccgagctcctcgtcgccgccgcggggatgatggcggaggctcgcttc
ggcgtcatcatagtcgactccgtcaccaatctgttccgcaccgagtacgagggtcgcggc
gagctcagcgcgaggcagatgcacctgggcaagttcctccgccacctgaccaggctggct
gacgaatttggcgtcgccgtcgtggtgaccaaccaggtggtggccaaccctgatggaaac
gccatgttcgcgggagccaacgcgctcaagccaatcggcggaaatatcatggcgcacgcg
tcaaccactcgcatcgcgctgcgcaagggcaggggcgagaaccgcatcgccaagattgcc
tgctcccccgtgctgcccgagtcggaggcgcagttctccatctccgagctcggcattgag
gacgcaaaggactga

DBGET integrated database retrieval system