KEGG   Micromonas commoda: MICPUN_113565Help
Entry
MICPUN_113565     CDS       T02695                                 

Definition
(RefSeq) hypothetical protein
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
mis  Micromonas commoda
Brite
KEGG Orthology (KO) [BR:mis00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mis01001]
    MICPUN_113565
Enzymes [BR:mis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     MICPUN_113565
Protein kinases [BR:mis01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   MICPUN_113565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 8250317
NCBI-ProteinID: XP_002507767
JGI: MicpuN3_113565
UniProt: C1FEX0
Position
1:complement(join(2002198..2002286,2002328..2003228))
Genome map
AA seq 329 aa AA seqDB search
MDDILLDPAGSGGEFGHVKLNKKGSFKDFYKVGSILGEGAFGVVRLVTCKSDHSKWAVKV
IEKSKVDPGDHSLQTEIDILCRVKQPNCICLREWFDEPTRVLLVMELVTGGTLLDHIVNS
GHFNEEVGRTIFRDLATGLEYLHAHGIAHRDLKPENFMLSSKSPDARVKLADYGLSKILI
DPAGGNEKTVCGTPSYVAPEILRCMTGKEETYNAINADAWSLGVNLFIILSGYPPFWRHE
QNQKKLFDAIGRNDWSFDQTCWKDISVDAKSLIKGLMEPDVEKRYTVKQALQHKWCAETA
IYAQVQKSGTGRAIQNSFDPPGYWAQEHW
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggacgatatcctgctggacccagcagggagtgggggtgagtttggtcacgtcaagctc
aacaagaagggaagcttcaaggatttttacaaggttggctcaatcttgggcgagggcgct
ttcggggtggtgcgcttggtcacgtgcaaatcggatcattccaaatgggccgtcaaggtg
atcgaaaagagtaaagtcgatcctggtgaccactcgctgcaaactgaaatcgacatcttg
tgtcgtgtcaagcaaccgaactgcatctgcttgagagaatggttcgacgagccaacccga
gtacttctggtgatggagctcgtcacgggtggcaccttacttgaccacatagtcaacagc
ggacatttcaacgaagaagttggacgcacgatttttcgtgatctagccacggggttagaa
tacctgcatgctcatgggatcgctcatcgggacttgaagcctgagaacttcatgctcagc
tccaagtcgcccgacgcgcgtgtcaaactggcagattacggtctgtcgaagattctcatc
gatccagccggaggtaacgaaaagacggtgtgcggaactccgagctacgtcgccccggaa
atactgcggtgcatgacgggaaaagaagaaacctacaacgcgattaacgccgacgcgtgg
tcgttaggtgttaatcttttcatcattctcagcgggtacccgccgttctggagacacgaa
caaaatcaaaagaaattgttcgacgccataggtcgcaacgattggtcgtttgatcaaacc
tgctggaaagacatcagcgtcgatgccaaaagtttgataaaaggtttgatggaaccggac
gtcgaaaagaggtacaccgtgaagcaggcgctgcagcacaaatggtgcgcggagacggcg
atttacgcacaggttcaaaaaagcgggactggccgtgctattcaaaactcgtttgacccg
cctggttactgggctcaagaacactggtaa

DBGET integrated database retrieval system