KEGG   Micromonas commoda: MICPUN_56330Help
Entry
MICPUN_56330      CDS       T02695                                 

Definition
(RefSeq) predicted protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
mis  Micromonas commoda
Pathway
mis00071  Fatty acid degradation
mis00410  beta-Alanine metabolism
mis00592  alpha-Linolenic acid metabolism
mis00640  Propanoate metabolism
mis01040  Biosynthesis of unsaturated fatty acids
mis01100  Metabolic pathways
mis01110  Biosynthesis of secondary metabolites
mis01212  Fatty acid metabolism
mis04146  Peroxisome
Module
mis_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MICPUN_56330
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MICPUN_56330
   00592 alpha-Linolenic acid metabolism
    MICPUN_56330
   01040 Biosynthesis of unsaturated fatty acids
    MICPUN_56330
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MICPUN_56330
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MICPUN_56330
Enzymes [BR:mis01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     MICPUN_56330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 8241165
NCBI-ProteinID: XP_002499971
JGI: MicpuN3_56330
UniProt: C1E031
Position
2:complement(489280..490944)
Genome map
AA seq 554 aa AA seqDB search
MPYISVDALVGDGPVAPPPTLADGGRVSENALRDWGAPPANVDEDPKRVAWRANYTAELA
RVLNTPADDYHDSAARLSGLVKSALLEFRHLKTEPSKFFEAHRLLVNHGFEQGPGFSIRF
TVQYNLFAGTVLELGGPEHLRTLDEMQRNGELGCFALTEKLAGVNSGLVVQTTARWVPDE
GAFLLHTPHDGACKNWISQGLTACKAVVMADLIVGGESKGPHAFLVELRAKGSGPGYPGR
TSTGVTLGDMGAKTTGNDLDNAWISFENKWIPRESLLDRYCDLTVDGGYVPRGGTSAPMS
NMELIGQRLFTGRVAVAQGAHEFRRRLFRRTRAHNDAKPCWAPGGGSHSAKKTLMLSSVP
QLRALYRDADAKEARMTAYLASVERDLCETLTNGTRPSAEMVEAVAAAKVSAVDEAIEYC
HRLKQEVGSYALMAGTGFEHTDFLQCCKFAEGDSRILLMKVARDRVKAYGRIAAKGGEFP
SWMSPREAKAVAELAKALQASAAGGKRPAEAWEEHWDKAYATARLAVDDIVTRRVGGPDK
WSNAGWRSTPASRL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgccttacatctccgtcgacgccctcgtgggtgacggacccgtggctccgcccccaacg
ctcgccgacgggggccgcgtctcggaaaacgccctccgagattggggcgctccacccgcg
aatgtcgacgaggacccgaagcgcgttgcgtggcgcgcaaactacaccgccgagctcgcg
cgcgtgctcaacacccccgcggacgactatcacgactccgccgcgcgactcagcggcctc
gtcaagtccgcgctcctcgagttccggcacctcaagacggaaccgtccaagttcttcgag
gcgcaccggctgctcgtcaatcacggcttcgagcaggggccgggattcagcatcaggttc
acggtccagtacaacctcttcgccgggaccgtgctcgagctcggaggtcccgaacacctg
aggacgctcgacgagatgcagcgaaacggcgagctcgggtgctttgcgctcaccgagaag
ctcgcgggcgtcaactccgggctggtggttcagacgacggcgaggtgggtcccggatgag
ggcgcgttcctgctgcacacgccccacgacggcgcgtgcaagaactggatctcgcagggt
ctgacggcgtgtaaagcggtggtcatggcggacctcatcgtcggcggcgagagcaaggga
cctcacgcgttcttggtcgagcttcgcgcgaaaggttccgggccggggtatcccggccgg
acatcgacgggggtgaccctcggggacatgggcgccaagaccacgggtaacgacctggat
aacgcgtggatatccttcgagaataagtggatcccgcgcgagtccctcctggaccgatac
tgcgacttgaccgtcgacggcggatacgtcccacggggcggaacctcggcgccgatgtcg
aacatggagctcatcggccagcgcctcttcaccggccgagtcgccgtggctcagggggcg
cacgagttcaggcgccggctgttccgcagaacgcgagcgcataacgacgcgaagccgtgc
tgggctcccggcggcggcagccacagcgccaagaagacgctgatgctgtcgtcggtgccg
cagctgagagccctgtatcgcgacgccgacgcgaaggaggcgaggatgaccgcctacctg
gcctcggtggaacgggacctgtgcgagacgctcacgaacggtacgaggcccagcgcggag
atggtcgaggcggtggcggcggcgaaggtctccgcggtggacgaggcgatcgagtactgc
cacaggctgaagcaggaggttggctcctacgcgctgatggccggcaccgggtttgagcac
acggactttcttcagtgctgcaagtttgccgaaggcgacagcaggatcctgctcatgaag
gtggcgcgcgatagggtcaaggcgtacggtcgcatcgcggcgaagggcggcgagtttccc
tcgtggatgtcgccgagggaggcgaaggcggtggctgagctggcgaaggcgctccaagca
tccgccgccgggggaaagaggccagcggaggcttgggaggaacactgggacaaggcgtac
gccaccgcgaggttggcggtggatgacatcgtgaccagacgcgtaggcgggccggataag
tggtccaacgctgggtggcgctcgacgcctgcgagccggttatag

DBGET integrated database retrieval system