KEGG   Micromonas commoda: MICPUN_58037Help
Entry
MICPUN_58037      CDS       T02695                                 

Definition
(RefSeq) predicted protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mis  Micromonas commoda
Pathway
mis03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mis00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    MICPUN_58037
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mis03041]
    MICPUN_58037
Enzymes [BR:mis01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     MICPUN_58037
Spliceosome [BR:mis03041]
 Complex C
  Other components
   Step II factors
    MICPUN_58037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 AAA_22 DEAD AAA_19 AAA_30 T2SSE DUF2075 AAA_14 Flavi_DEAD PhoH ABC_tran
Motif
Other DBs
NCBI-GeneID: 8243144
NCBI-ProteinID: XP_002501463
JGI: MicpuN3_58037
UniProt: C1E4H2
Position
4:join(1157997..1160078,1160302..1161732)
Genome map
AA seq 1170 aa AA seqDB search
MSALNKLAHLSLVNKVTTELENHIGIADKTLSEFIIDLAGKHDEPRAFQKALEDAGAELS
FDLVRSLLAIIQRMKPGGNKGGAGGGGGGVGGAGGPPRPVRPTADNPLPGLAVRDDVERA
KALTREIYGDNPITANMADDPRFLDRRDDDRGRGGRDRSRDRDSGRGGRDRSRDRGRSRD
RGGGSSSAAALKNGEPEVGAIYRGRVTNVMDFGCFVELTEFSRKFEGLVHVSMISSQKGV
NARDQVQRDQSVWVKVTTRSATRMALSMRDVNQSTGDDLLGGGGNEGSANGYANPAGPAA
NRLGQSLRGLSGITPTAEDVAGDTRRRPVKRLSSPERWEAKQLIASGVLKTEEYPTYDAE
NEGLLAYEEEAEQEIEIEINEDEAPFLAGQTANGGDVSPIKIVKNPDGSLQRAAMTQSAL
AKERRELKEQQQRTALESIPKDLNRPWEDPMPEAGERHLAAELRGVGLGGYEMPQWKVEA
FGKAPTFGQKSSLPMQAQRESLPIFKLRDELIQAVNDNQVLVVIGETGSGKTTQMTQYLA
ESGYTSRGRIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTSPETVIKYMTD
GMLLREALLDDALSQYCLIMLDEAHERTIHTDVLFGLLKKCCAKRKDLKIIVTSATLDAE
KFSSYFFNCPIFTIPGRTFPVEVLYTKAPETDYMEDDTHLSQTIRKLSQDAALITVMQIH
LTEPEGDILLFLTGQEEIDTSCQILFERMKGLGPSVPDLHILPVYSSLPSEMQTRIFEPA
PPGSRKVIVATNIAEASLTIDGIYYVVDPGFAKQKVFNPKVGMDSLVVAPISQASARQRA
GRAGRTGPGKCFRLYTESAYKNEMLPTSVPEIQRTNLGTTTLTLKAMGINDLLHFDFMDP
PPPQTLISALEQLYNLGALDEEGLLTRLGRKMAEFPLEPPMSKMLIAAVDLGCSDEILTI
VACLSAQNIWFRPREKQAAADQKKAKFFQPEGDHLSLLTVYESWKAQKFSSPWCFENYLQ
ARSLRRAQDVRKQLLTIMDRYKLDVVSAGRNFNKIRRAICSGFFFHSAKKDPQEGYKTVV
ENTPTYIHPASALFQRQPDWVVYHELVLTSKEYMRECCVIEPKWLAELAPRFFKLCDPRH
ISKRKRMERLEPLFDRFNDPQAWRLSKRRG
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgctcaacaagctcgcgcacctgtcgctggtgaataaggtgacgacggagctc
gagaaccacataggcatcgcggacaagaccctctcggagttcatcatagacctcgcgggg
aagcacgacgagccgagggcgttccagaaggcccttgaggatgccggcgcggagctgtcg
ttcgacttggtgcgcagcctcctggccatcatccaacgcatgaagcccggcgggaacaag
ggcggtgctggcgggggtggagggggcgtcgggggcgcgggcgggccgccgagacccgtg
agacccaccgccgacaatcccctcccggggctggcagtgcgcgacgacgtggagcgcgcc
aaggcgctgacccgggagatctacggcgataaccccatcaccgcgaacatggcggacgat
ccgaggttcctcgacagacgcgacgacgacagggggcgcgggggcagggaccgcagccga
gatcgcgactcgggccggggcggcagggatcgatcgagggacaggggccgctccagggac
cggggcggcggctcctcctccgcggcggcgctcaagaacggcgagcccgaggtgggcgcc
atctatcgcggcagggtcaccaacgtcatggacttcggatgcttcgtcgagctcaccgag
ttcagccgcaagttcgaggggctcgtgcacgtctccatgatctcgtcgcaaaaaggggtc
aacgccagagatcaggtccagcgcgaccagagcgtgtgggtcaaggtcaccacgcgatcg
gccacgcgcatggcgctcagcatgagggacgtgaaccagtccacgggagacgacctcctc
ggcggcggggggaacgaaggatcggccaacgggtacgccaaccccgccggacccgccgcg
aaccgactcggccagtccttacgcggcttatccggaataacccccaccgcggaggacgtc
gccggggacacgaggcggcggccggtgaagaggctctcgtccccggagcgttgggaggcg
aagcagctcatcgcgtccggggttttaaagacggaggagtaccccacgtacgacgcagaa
aacgaggggctgctcgcgtacgaagaggaggcggagcaggagattgagattgagatcaac
gaggacgaggcgccgtttctggcggggcagacggctaatggcggggacgtgtcgccgatc
aagatcgtgaagaaccccgacgggagtttgcagcgcgcggcgatgacgcagagcgcgctg
gcgaaggagaggagggagctcaaggagcagcagcagaggacggctttggagtccatcccg
aaggacctcaaccggccttgggaggatcccatgccggaggctggcgagcggcacctcgcc
gcggagctcaggggcgtgggcctgggagggtatgagatgccccagtggaaggtggaggcg
ttcggcaaggcgcccacgtttggccagaagtcgtccctgcccatgcaggcgcagcgcgag
tcgctcccgattttcaagctgagggacgagctcatccaggcggtgaacgataaccaggtg
ctcgtggtcatcggcgagaccggatccggtaagacgacgcagatgacccagtacctggcg
gagagcggttacaccagcaggggacggatcgggtgcactcagccgaggcgcgtggcggcg
atgtccgtggcgaagcgcgtggctgaggagtttggatgccgactcggcgaggaggttggg
tacgcgattcgattcgaggactgcacgtcgcccgagactgtgatcaagtacatgacggac
ggtatgctgctcagggaggcgcttctcgacgacgcgctgtcgcagtactgcttgatcatg
ctcgacgaggcgcacgagaggacgattcacaccgacgtcttgttcggcttactgaagaag
tgctgcgccaagcggaaggacctgaagatcatcgtgacgtccgcgacgctggacgcggag
aagttctcgtcgtatttcttcaactgcccgatcttcacgatcccgggacggacgttcccg
gtggaggtgctgtatacgaaggcgcccgagactgattacatggaagacgacactcacctt
tcgcaaaccattcgcaaactctcgcaggacgccgcgctaatcaccgtcatgcagattcac
ctcaccgaacccgagggcgacatcctcctcttcctcaccggccaggaggagatcgacacg
tcgtgccagatcctcttcgaacgcatgaagggcctcggtccctccgtgcccgacctccac
atcctccccgtgtactcgtcgctcccgtcggagatgcagacgcgaatcttcgagcccgcg
ccgcccggttcccgcaaggtcatcgtcgccaccaacatcgccgaggcttcgctcacgatc
gacggcatctactacgtcgtcgacccgggattcgcgaagcaaaaagtcttcaacccgaag
gttgggatggactcgctcgtggtggcgcccatctcgcaggcgtcggcgaggcagcgagcc
ggacgagcgggtcgaaccgggcccggcaagtgcttcaggctgtacaccgagagcgcgtac
aagaacgagatgctccccacgtccgtcccggagattcagcgcacgaacctgggcaccacg
acgctgacgctgaaggcgatgggtatcaacgatctcttgcacttcgatttcatggacccg
cccccaccgcagacgctgattagcgcgctggagcagctctacaacctcggcgcgctcgac
gaggagggactgctgacgaggctcgggcgcaagatggccgagttcccgctcgaacccccg
atgagcaagatgctcatcgctgcggtggatctggggtgctcggatgagattttgaccatc
gtcgcgtgcctatccgcgcagaacatctggttccgaccgagggagaagcaggcggcggcg
gatcagaaaaaggcgaaattcttccagcccgagggcgaccacctgtccttgctcaccgtt
tacgagagctggaaggctcagaagttctcgtcgccgtggtgcttcgagaactaccttcag
gcgagatcgctgcgaagggcgcaggacgtgcgaaagcagctgctgaccatcatggacagg
tacaagctcgacgtggtctccgccgggcgaaatttcaacaagattcgccgagcgatttgc
tccggatttttctttcacagcgcgaagaaggatcctcaggagggatacaagacggtcgtc
gagaacacgcccacgtacattcaccccgcgtcggcgctgtttcagaggcaaccggactgg
gtggtgtaccacgagctggtgctcacgtcgaaggagtacatgcgcgagtgctgcgtcatc
gagccaaagtggctagcggagctggcgccgaggttctttaagctgtgcgatccgaggcac
atctcgaagaggaaaaggatggagaggctggagccgctgttcgatcggttcaacgatccg
caggcgtggcgcctgtccaagcgccgcggctga

DBGET integrated database retrieval system