KEGG   Micromonas commoda: MICPUN_58148Help
Entry
MICPUN_58148      CDS       T02695                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mis  Micromonas commoda
Pathway
mis00450  Selenocompound metabolism
mis00970  Aminoacyl-tRNA biosynthesis
mis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mis00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MICPUN_58148
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MICPUN_58148
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mis01007]
    MICPUN_58148
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mis03016]
    MICPUN_58148
Enzymes [BR:mis01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MICPUN_58148
Amino acid related enzymes [BR:mis01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MICPUN_58148
Transfer RNA biogenesis [BR:mis03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MICPUN_58148
 Prokaryotic type
   Other AARSs
    MICPUN_58148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f GST_C_2 Anticodon_1
Motif
Other DBs
NCBI-GeneID: 8242802
NCBI-ProteinID: XP_002501917
JGI: MicpuN3_58148
UniProt: C1E4T3
Position
4:complement(1370512..1373307)
Genome map
AA seq 931 aa AA seqDB search
MAPMNLACRGADPRAMKAFIAAAISGAELKFVPMAKGAEGHGGSPVALDVDDKKMKISEP
NAIARYLGASKALAPAGPARWATERWCEWEATALAPAVAVACASNDGASLLTLLANVLEP
HLSATSSTFAFIAGGDAPSLADVVVYSALFPVLGEERAAGVVGLDALDGTVPRVAAWFAR
CGETASFIAGASSSRASATTAASLCAQDGQAMVLAAAANAPPTDPSGEKFCITTAINYAN
GAPHMGHAYEAISADCIARYHRRYGRDVLFQTGSDEHGQKIAEAAETAGCAPIELCDKYV
NAFQTLNAKTKVSNDVYNRTTSESHKAACRKLFEMSKANGDIYLDTYEGWYNVREETFVT
ETDAAAANYLDPVSGKPLKKMKEESYFFRQSRYQSRLIEHIEKNPAFIQPTRRRNEILAR
LREDELRDLSVSRTTFDWGIPVPDAPGHVMYVWFDALTNYLTGTGWPQKPNGDGMWPASV
HIIGKDIIWFHCVIWPCMLWSAGLPLPKTVFGHGFVTAADGQKMSKSIGNVVDPMDQLTR
YSSDTFRYYLMRNAVYGSDVPFSESNLVYVHNSDLADVMGNLVHRATNLCNKNCGGVVPD
CVPEKVFDVNLLRVQSEQAMSNLEVQRCCELAINAMKDTNKYLTDSAPWAVKGDGAAERK
AVIIRSTLEAVYAAAHFLAPFIPDACDAIFEKLGTPAVPAWKLKRSENLAPGTAVSVGDI
LFAKHEVEGADKGADKGAEGAKGGDAKGKKAADAPKPKKKEVPANAPVDVSRLNIVVGTV
TKVARHPEAEKLYVEAIDLGPALGTKQVVSGLVEHVPEDQMMGARVVVVANMKPSKMRGV
ESAAMVLCGTGPDGKVELVTPPEGVPNGERVQCEGFAGEADDVLNPKKKVFENVAPDFSV
TPSGEASYKGAAFGTSGGACRLATLTAGTIR
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggctcccatgaacctcgcgtgccgcggcgcggacccccgggcgatgaaggctttcatc
gccgccgccatctccggcgcggagctcaagttcgtccccatggcgaagggcgcggagggc
cacggcggatcccccgtcgcgctcgacgtcgacgacaagaagatgaaaatctccgagccc
aacgccatcgcccggtacctcggcgcgtccaaagccctcgcgcccgcgggacccgcgcga
tgggcgacggagagatggtgcgagtgggaggcgaccgcgctcgcccccgccgtcgccgtc
gcgtgcgcgtccaacgacggcgcctcgctcttaacgctcctcgcgaacgtcctcgagccg
cacctttccgcgacgagctcgactttcgcgttcatcgcgggcggcgacgcgccgtcgctc
gctgacgtcgtcgtctactccgcgctcttccccgtcctcggcgaagagcgcgccgcgggc
gtcgtcggtctcgacgccctcgacggcaccgtcccgcgcgtcgccgcgtggttcgctcgg
tgcggagagacggcttcgttcatcgccggcgcgtcgtcgtcgcgagcgtccgcgacgacc
gcggcgtcgctctgcgcgcaggacggccaggcgatggtcctcgccgcagcggccaacgcg
ccaccgacagatccgagcggcgagaagttttgcatcaccaccgccatcaactacgcaaac
ggagcgccgcacatgggtcacgcgtacgaagccatctccgccgattgcatcgctcggtat
caccggcgctacggccgcgacgtgttgttccagacgggttccgacgagcacgggcagaag
atcgccgaagccgcggagacggcggggtgcgcgcccatcgagctgtgcgataagtacgtc
aacgcgttccagacgctcaacgcgaagacgaaggtgagcaacgacgtgtacaaccggacg
acgtcggagagtcacaaggcggcttgccggaaactgttcgagatgtccaaagcgaacggg
gacatctacctggacacctacgagggatggtacaacgtccgcgaggagacgttcgtgacg
gagacggacgccgcggctgccaactacctcgaccccgtcagcggcaagcccctcaagaag
atgaaggaggagtcctatttcttccgccagtcgaggtaccagtcgcggctcatcgagcac
atcgagaagaacccggcgttcatccagcccacgcgcaggcgcaacgagatcctcgcgagg
ctccgcgaggacgagctcagggacctgtccgtgtccaggacgacgttcgactggggcatc
ccggtgcccgacgccccgggccacgtcatgtacgtttggttcgacgcgctgaccaactac
ctcaccggcacgggttggccgcaaaagcccaatggcgacggcatgtggcccgcgtccgtt
cacatcatcggtaaggacatcatctggttccactgcgtgatctggccgtgcatgctgtgg
tccgcggggctgccgctgccgaaaaccgtctttggtcacggattcgtcacagccgcggat
ggtcagaagatgtccaaatcgatcggcaacgtcgtcgatcccatggatcagctcaccagg
tactcgtccgatacgttcaggtactacctcatgcgcaacgccgtgtacggcagcgacgtg
ccgttcagcgagagtaacctcgtgtacgtgcacaactctgacctggcggacgtgatgggt
aacctggtgcaccgcgcgacgaacctgtgcaacaaaaactgcggcggcgtcgttcccgac
tgcgtcccggagaaggtcttcgacgtcaacctcctgcgcgtgcagagcgagcaggcgatg
agcaacctggaggttcagcggtgctgcgagctcgccatcaacgccatgaaagataccaac
aagtacctcaccgattccgcgccctgggcggtcaagggcgacggcgccgcggagcgcaag
gcggtgatcatcaggtccacgctcgaggccgtgtacgccgccgcgcacttcctcgcgccg
ttcatcccggacgcctgcgacgccatcttcgagaagctcggcacgcccgcggttcccgcg
tggaaactgaagcgctccgagaacctcgcccccggcacggcggtgtccgtcggggacatc
ctcttcgcgaagcacgaggtcgagggtgccgacaagggtgccgacaagggtgccgagggt
gccaaaggcggggatgccaagggaaagaaggctgccgacgcgccgaagccgaagaagaag
gaggttccggccaacgcgcccgtggacgtctcccgcctcaacatcgtggtcggcaccgtg
accaaggttgcccgccaccccgaggctgagaagctctacgtcgaggccatcgacctcggc
ccggcactcggcaccaagcaggtggtctcgggcctcgtcgagcacgtcccggaggatcag
atgatgggcgccagggtcgtggtggtggcgaacatgaagccctccaagatgcgcggagtg
gagtccgccgcgatggtcctctgcggcaccggcccggacgggaaggtggagctcgtgacg
ccgccggagggggtgcccaacggcgagcgcgtccagtgcgaggggttcgcgggcgaggcg
gacgacgtgttgaacccgaagaagaaggttttcgagaacgtggcgccggacttttcggtg
acgccatccggggaggcttcgtacaagggcgccgcgttcgggacgagcggcggggcgtgc
aggctcgccacgctcaccgcggggaccatcaggtga

DBGET integrated database retrieval system