KEGG   Micromonas commoda: MICPUN_58883Help
Entry
MICPUN_58883      CDS       T02695                                 

Definition
(RefSeq) isochorismate synthase
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
mis  Micromonas commoda
Pathway
mis00130  Ubiquinone and other terpenoid-quinone biosynthesis
mis01100  Metabolic pathways
mis01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mis00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    MICPUN_58883
Enzymes [BR:mis01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     MICPUN_58883
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     MICPUN_58883
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     MICPUN_58883
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     MICPUN_58883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind TPP_enzyme_N MR_MLE_C Abhydrolase_6 Abhydrolase_1 TPP_enzyme_M_2 TPP_enzyme_C Hydrolase_4 Thioesterase TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 8243574
NCBI-ProteinID: XP_002502659
JGI: MicpuN3_58883
UniProt: C1E747
Position
5:complement(1252273..1259643)
Genome map
AA seq 2456 aa AA seqDB search
MSAAGLRASLAPRASAASGGRAGDGRARRAAKARPAPRRRDRSPIRDADAATRTTAPAVS
ADAVQVVAPTTLEDRSSDPAIGDASAPARPPVETCQHVHLGSASSIAEALARVRAGLRGL
TQDASGHDGASGGGSMPPFASGVVRLTVAVPRTVDALEWLRSLPDDDDLNDDGEGGDDVK
AALLPRYYLSPRTPPPAIRSGEGDDGGDENRHRQGVHDRGKGSGPMNDDGGADGGADGGA
DGSRTRRRPQAEPPEWRADPRGAAAAAGAACVWTGPSAFGADVLADQRRFLDTGEPHDTA
PRVYGAGRFDADSDCAVGDEWASFGGHYFFLPTLEVVEGARCATVACCVAWDAAGGAACR
DGFAAAVAAAVTAVDAASRPVARSRGGARSQQSPSSPSPSSSSGLTRSTRERRLPPGASD
VTGRVLEPDQEGWVRTVDGLLRALREGEEAARGGRAGSDADGDGDEDDGVNESFQSSPPR
VWDEKDAYGDDRYMENFAAQSNWKEVLGEVGDGDERGTNGGTTDGADRSLRDRLLELGRS
AGVEAPPASVLEDLEAFAMAAGIGGASDVLTGSANGRRRGKTGRNGNPRNADVGAIGMGW
SVDESVDENEAVADVEAIADAVAAVPSNANTDGTDLAPLRKVVLARRTKLTLGSPVNPLA
LVAALKARDPDAYQFALIHADGAAFVGSTPERLFSARDGHAASEAVAGTRPRGSDEGEDA
ALAYEMLLSPKEHEEFAIVREEVRRALGTVAEGGPGGVKAELEKGVLRHFSVQHLYARLG
AALAPGKSEADVLNALHPTPAVCGFPRRAALDAIRVAEPFDRGLYAGPIGWVGVDSAEFA
VAIRSALVSPAGDDISLYAGVGVVAAADPAAEWRELNLKTRPLEALLAKRPTLADAPNAN
QAWADLIVGELVRGGVGVFCVAPGSRSTPLTLAAERHPTARVVVCIDERSLGFYALGYGK
GSGKAAAVITSSGTAVANLLPAAVEAHESCAPLLLLTADRPPELRDTSANQTIDQVKIFG
SYARFGVDLAPPGDGSPARVAATAVATAVRHLHGPRPGPVHVNCQFRDPLGPSGAEWDVR
RDLRGFDGWERTSAPFTSGAPHASSSSSSEDLSELAALIRSARKGLLVVAGGGDASDALA
AAELARTLGWAVVADAASGLRVKGGASSSLKSSLRSSSRSSSSSSHDLEWSAASAECPGL
VNTLDLMLVSDEIRDYVGETDVILQLNPRVTSKRVQQMLESAAMERGAAWACVAASERRA
DPGHCVSLHVACDVPRVAEGLARLLDDVDSDSADGRYGGRYCASENARSCARFKETLLAC
DAAASREACAALGDIEAAEGISEMAVALAVTENLPPSAGLFIGNSMPIRDVDMLSGIRRR
VGTDAGRHPIGANTSSRSLGSGAGPGAPVCANRGASGIDGVVSSAAGYAAGLGRPVTLLI
GDVSFQHDANGLLLLRERPGQPPVTVVVVNNGGGGIFSFLPVADQIDSGSFTKLFATPPD
VSRRGLCDAHRVAHSHPSTPEALKRALDAAWSEGRHSVVEVTTSRARNLEQHRALQARVA
RAAACALDLRTRAALASASSSGMPRVASASVRGFELPMLKKPTTTEGEAKETAGTRRGHL
LRVQLDDGRVGWGEASPLPGLHAESTEDAGAQLRAMAALLDGGDGGGGVLAPPELPLLGG
AVSEWLRGVVGVVDPDASLLPSVRFAVESAVLSALASPGAPLADVLLFGSVQRRGASKKT
NEGGEGGESVDPTDDPTSHQSVEINALIEAGLAPSAAAAEALRLVRLGHGCVKLKVARGE
GSAGAMEDAARLRAIRTAVGPDVALRADANRRWSLNDALSFGLQCAELDLEYVEEPVADP
ANNLAAFHCTTGVPVALDETVDECAVAAKAAGTDIERALAEYFEPTFGVAALVLKPSVLG
GLEATAACAAAARSRGVNVVVTTSFESGVGVATCANLAAAMDAAAVDAAAAARAEDDARA
RAERIGIEANDGDDVSLPFRASREARMRLMNSIDRGTFELGDGEVAGSIPGGNGNGGGSF
GWEDESHRSPVASLRAMRHGLGTGAWLDGDAVTPPAAPLASLPGGGVGVDLGRLPRDLVV
SNETASAAAASAAAKVGSSYAGWGVESRHEVETSHGKYSFRVLDSGNAPPFTPDSDSALA
PPPVVFLHGFMGGAEDWNAIASAVAPERRCVAVDLPCHGRSRFVPSSERANDEGLSVEAV
AEAVAVLITERVCPAGAKGAVLVGYSMGARVALRAATSHPGCAAAVAAIGGSGGIRGDVQ
RNMRADRDDAMAAALAKGGLAAFAGAWYRQGLFRALASHPRWRDGAIARRRCKIPNFESS
DGDEEDEDEDEDGVARDLARVLASMSPGRQAVVTGDDLAGIHRGAVGGLTLLAGDLDAKF
IATAYAMAADANAVLERDEDGGDGVEVVTVPGAGHAVHLEAPEGLVLPILRVVRRT
NT seq 7371 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcgggattgcgcgcgtccctcgcgccccgcgcgtccgccgcatccggcggt
cgggcgggcgatggacgagcgcgacgcgccgccaaggccaggcccgcgcccaggcgccgc
gaccgctcgcccatccgcgacgccgacgccgcgacgaggacgaccgccccggccgtctcc
gccgacgcggtgcaagtcgtcgcgccgacgacgctcgaggatcgctcctcggatcccgcg
atcggcgacgcgtccgcgcccgcgcgcccacccgtggagacgtgccagcacgtccacctc
ggctcggcgtcgtccatcgccgaggcgctcgcgcgcgtccgcgcgggcctccggggtctc
acgcaggatgcgtcgggccacgacggcgcgtcgggcggcgggtccatgccgccgttcgcc
agcggcgtcgtccgcctcaccgtcgccgtgccgcgcacggtggatgcgctcgagtggctc
agatccttacccgacgacgacgatcttaacgacgacggcgaaggaggcgacgacgttaaa
gccgcgctgctgcccaggtactacctcagccctcggacgccgcccccggcgatccgatcg
ggcgagggcgacgacggcggcgacgaaaaccgccaccggcagggcgtccacgacaggggc
aagggttcgggtccgatgaacgacgacgggggtgccgacgggggtgccgacgggggtgcc
gacgggtcgcgaacgaggaggaggccgcaggcggagccgcccgagtggcgcgccgacccc
cgcggcgccgccgccgccgccggcgccgcgtgcgtctggaccggtccgtcagcgttcggc
gcggacgtcctcgcggaccagcgcaggttcctcgacaccggcgagccgcacgacaccgcc
ccgcgcgtgtacggcgccggaaggttcgacgcggattcggattgtgccgtaggcgacgag
tgggcttcgttcggcgggcattactttttcttgccgacgctggaagtggtggagggcgcg
aggtgcgcgacggtggcgtgttgcgtggcgtgggacgccgcgggcggggcggcgtgccga
gacgggttcgcggcggcggtcgcggcggcggtgaccgcggtggacgcggcgtcgcgaccc
gtcgcgcgctcgcgcggcggggcccgctcgcagcaatcgccgtcatccccatccccgtcc
tcgtcgtcgggattgacgcgatcgacgcgagaaagaaggctgccgccgggcgcgtctgac
gtcaccggaagggttctggaacccgaccaggagggttgggtgcgcaccgtggacgggctc
ctgcgcgcgctgagggagggcgaggaggctgcgcggggaggccgcgccggctcggacgcc
gacggggatggggatgaggatgacggggttaacgaaagtttccaatcttcgccgccgagg
gtttgggacgagaaggacgcgtacggcgacgaccggtacatggagaacttcgcggcgcag
agcaactggaaagaggtgctcggggaggttggcgacggcgatgaacgcgggacgaacggc
gggacgaccgacggcgccgatcggagccttcgcgatcgtctcctcgagctcggtcgatcc
gccggcgtggaggcgccgccggcgtcggtgctggaggacctggaggctttcgcgatggcc
gcgggcatcgggggcgcgagcgacgttctaacgggaagcgcgaacggacggcggcggggg
aagacggggaggaacgggaacccgcggaacgccgacgtcggcgccatcggcatgggatgg
tccgtcgacgaatccgtcgacgagaacgaagccgtcgccgacgtcgaagccatcgccgac
gccgtcgcggcggtgccgtcaaacgcaaacacagacggcaccgacctcgcgcctcttcgc
aaggtggtcctcgcgcgacgcaccaagctcactttgggatcccccgtgaaccccctcgcg
ctcgtcgcggcgctaaaggccagggacccggacgcgtaccagtttgcgttgattcacgcc
gacggagccgcgttcgtcggatccacccccgagcggctgttcagcgccagggacgggcac
gcggcgtcggaggctgtggccggaacaaggccgaggggttccgacgagggcgaggacgcc
gcgctcgcgtacgagatgctgctctcgcccaaggagcacgaggaattcgcaatcgtccgt
gaagaagttcgcagggcgctcggcacggtggcggagggcggccccggcggggtcaaggcg
gagctggagaagggcgtcctccgccacttctccgtgcagcacctctacgcccgtttgggc
gccgcgttggcgcctggaaagagcgaggcggacgtgttgaacgcgttacatccgacgccc
gcggtgtgcggcttcccgaggcgagcggcgctcgacgcgattcgagtagccgaacccttc
gaccggggtttatacgccgggcctatcggttgggtcggcgtcgactcggcggagtttgcc
gtcgccattcgcagcgcgctggtgtcccccgccggcgacgacatctcgctgtacgcgggg
gtcggggtggtggcggcggcggatcccgccgcggagtggcgcgagctcaacctcaagact
cggccgctcgaggcgctcctcgccaagcggccgacgctggctgacgctccgaacgctaac
caggcctgggcggacctcatcgtcggcgagctggtcaggggcggcgtcggcgtcttctgc
gtggctcccggatcgaggagcacgccgctgacgctcgccgcggagaggcatcccacggcg
agggtcgtcgtgtgcatcgacgaacggtcgctcggtttttacgcgttgggctacgggaaa
gggtccggcaaggccgcggcggtgatcacgtcctcggggacggccgtcgcgaacctgcta
cccgcggcggtggaggcgcacgagtcgtgcgcgccgctgctgctgctcaccgcggatagg
ccgccggagctgcgcgacaccagcgccaaccaaaccatcgaccaggtgaaaatattcggt
tcctacgcgaggttcggggtggacctggcgccccccggggacggctcacccgcgcgcgtc
gcggcgacggccgtcgccaccgccgtgcgacacctgcacggcccgcgacctgggccggtg
cacgtcaactgccagttcagagacccgctcggaccgtccggggcggagtgggacgttcgc
cgcgacttgcggggttttgacgggtgggagcgaacctcggcgccgttcacctcgggcgcc
ccccacgcctcgtcctcatcctcgtcggaggacttgagcgagctcgcggcgttgatcagg
tcggctcggaagggtttgctcgtggtggctgggggaggagacgcgtcagacgccctcgcc
gcggctgagctggcgaggacgctcgggtgggcggtcgtcgccgacgccgcctccggcctg
cgcgtcaagggcggcgcgtcgtcgtcgttaaaatcgtcgttaagatcgtcgtcaagatcg
tcgtcgtcgtcgtcgcacgacctcgagtggtccgcggcgtcggcggagtgtcccgggctg
gtgaacacgctcgacctgatgctcgtctcggatgagattcgggactacgtcggcgagacc
gacgtcatcctgcagttgaacccgcgggtgacgagcaagcgcgtgcagcagatgctcgag
tccgccgcgatggagcgcggggcggcgtgggcgtgcgtcgccgccagcgagaggcgggca
gaccccgggcactgcgtgtcgcttcacgtcgcgtgcgacgtgccgcgagtcgcggagggc
ctcgcgaggctcctggacgacgtcgattctgattccgcggatgggcgttacggcgggcgt
tactgtgcctccgagaacgcgaggtcgtgcgcgaggttcaaggagacgctgctggcgtgc
gatgccgcggcgagtcgcgaggcgtgcgcggcgctcggggacatcgaagccgcggaggga
atctcggagatggcggtggcgctcgccgtcaccgaaaacctacccccgagcgcgggtctg
ttcatcggcaactcgatgcccatacgcgacgtggacatgctctccgggattcggaggcgg
gtgggtaccgacgccgggcggcaccctataggggcgaatacctcgagtaggtcgttgggt
tccggagccgggcccggggctcccgtgtgcgccaacaggggcgcgagcggcatcgacggc
gtcgtatcatccgccgccggttacgccgcggggctcggtcgtccggtgacgctgctcatc
ggggacgtgtctttccagcacgacgccaacgggctgctgctgctgagggagcgacccggt
cagccgcccgtgacggttgtggtggtgaacaacggcggcggcggcatcttttcgttttta
ccggtggcggaccagatcgactcgggttcgttcacgaaactcttcgcgacgcctccggac
gtttccagacgcgggctatgcgacgcgcacagggtcgcgcactcgcacccgagcaccccc
gaggcgctgaagagggcgttggacgcggcttggtccgaagggaggcacagcgtcgtcgag
gtgaccacgtctcgagctcgaaacttggagcagcaccgcgcgctgcaggctcgcgtggcg
cgcgcggcggcgtgcgcgctcgacctgcgcacgcgcgcggcgttagcgtcggcgtcgtcg
agcggtatgccccgcgtcgcgtccgcgtccgtgcgcgggttcgagctccccatgctcaaa
aagccgacgacgaccgagggcgaggctaaggagacggcggggacgcgacgcggacacctg
ctcagggtccagctcgacgacggcagggtgggctggggcgaggcgtccccgcttccgggg
ttgcacgcggagtccaccgaggacgccggcgcgcagctgcgcgcgatggcggcgcttctc
gacggcggcgacggcggcgggggagtgctcgcgccgcccgagcttcccctgctcggcggc
gccgtctccgagtggctccggggcgtcgtcggcgtcgttgaccccgacgcgtcgctgctt
ccgtccgtgcgtttcgcggtcgagtccgcggtgctctccgcgctcgcatcgccgggcgcg
ccactcgcggatgtgctcctgttcggttccgttcaaagacgaggagcttcaaaaaagaca
aacgagggaggcgagggtggcgagtccgtggatccgaccgatgatccgacgagtcatcag
tccgtggagatcaacgcgctcatcgaggctgggctcgcgccgagcgccgccgccgccgag
gctctccggctcgtccgcctcgggcacggatgcgtcaagctcaaagtcgccaggggagag
ggatccgcgggggcgatggaggacgccgccaggcttcgcgccatccgaaccgccgtcggc
cccgacgtcgccctccgcgccgacgccaacaggcggtggtccctcaacgacgccctctcg
ttcgggcttcagtgcgcggaattggacctggagtacgtcgaggagccggtcgcggacccc
gcgaataacctcgccgcgtttcactgcaccacgggggtacccgtggcgctcgacgagacc
gtggacgagtgcgcggttgccgcgaaagcggcgggcaccgacatcgaacgggcgctggcg
gagtacttcgagcccacgttcggggtggcggcgttggtgctcaagccctccgtgttgggc
gggttggaggccaccgccgcgtgcgcggcggcggcgagatctcgcggcgtcaacgtcgtc
gtcacgacgtcttttgaatccggcgtgggcgtggcgacgtgcgcgaacctcgcggcggcg
atggacgcggcggcggtggacgcggcggcggcggcgagggcggaggacgacgcgagggcg
cgagccgagcggatcggtatcgaagcgaacgacggcgacgacgttagcctcccgtttcga
gcgtctcgcgaggctcgcatgcgtctgatgaactccatcgaccggggaaccttcgagctc
ggtgatggggaggtcgcgggttcgatacccggcgggaacgggaacggtgggggttcgttc
ggctgggaggacgagtcgcatcggtcgcccgtcgcgagccttcgcgcgatgcgccacggg
ttgggcaccggcgcttggctcgacggcgacgcggtgactccacccgcggcgcccctcgcg
tcccttcccggcggcggcgtgggcgtggacctgggacgtctcccgcgcgatctcgtcgtt
tcgaacgagacggcgtcggcggcggcggcgtcggcggcggcaaaggtgggttcctcctac
gccgggtggggcgtcgagtcgcggcacgaggtggagacgtcccatggaaagtactcgttc
agggtgctggacagcgggaacgcgccgccgttcacgccagattccgattccgcgctcgcg
cccccgcccgtggtgttcctccacgggttcatgggcggcgcggaggactggaacgcgatc
gcgtcggcggtggcgccagagcggaggtgcgtagccgtggacctgccgtgtcacggacgt
tcgcgattcgttccctcttccgagagggcaaacgacgagggcctgagcgtcgaagccgtc
gccgaggctgtcgcggtgctcatcaccgagcgcgtgtgccccgccggcgcgaagggcgcg
gtgctggtcggctactccatgggagcgagggtggcgctgagggcggcgacgagccacccg
gggtgcgccgccgccgtcgcggccatcggcggctccggggggatccgcggcgacgttcag
cgaaacatgcgagccgatcgcgacgacgcgatggcggcggcgctcgcgaagggtggcctc
gcagcgttcgcgggcgcgtggtaccgccagggcctgttccgcgcgctcgcgtcgcacccg
aggtggagggacggcgccatcgcgaggcgccgatgtaaaatcccgaatttcgagtcgagc
gacggggacgaagaggacgaggacgaggacgaggacggcgtcgcgagggatctggcgcgc
gtgctcgcctcgatgagcccggggaggcaggcggtggtgaccggcgatgacctcgcgggg
atccaccgcggggccgtcggaggtttgacgcttctggcgggtgacctcgacgcaaagttc
atcgcgacggcgtacgcgatggccgcggatgcgaatgcggttttggaacgggacgaagac
ggcggggacggggtcgaggtggtgacggtgcccggggcggggcacgcggtgcacctggag
gcgccggagggtttggtgcttcccatccttcgcgtcgtgaggaggacgtag

DBGET integrated database retrieval system