KEGG   Micromonas commoda: MICPUN_60354
Entry
MICPUN_60354      CDS       T02695                                 

Definition
(RefSeq) predicted protein
  KO
K17292  tubulin-specific chaperone A
Organism
mis  Micromonas commoda
Brite
KEGG Orthology (KO) [BR:mis00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mis04812]
    MICPUN_60354
   04147 Exosome [BR:mis04147]
    MICPUN_60354
Cytoskeleton proteins [BR:mis04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     MICPUN_60354
Exosome [BR:mis04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MICPUN_60354
SSDB
Motif
Pfam: TBCA
Other DBs
NCBI-GeneID: 8245027
NCBI-ProteinID: XP_002504086
JGI: MicpuN3_60354
UniProt: C1EB97
Position
7:complement(join(1268009..1268098,1268257..1268508))
AA seq 113 aa
MADNKEALRALKIKTGVMTRVRKELAMYEQEVKTETEKLEAMKAEGRDPHDVKQQDQVLG
ESTMMIGDCKSRMESAFNDLLAAVEEHGPDCEGSEELTAAKAILDEVEPTLEV
NT seq 342 nt   +upstreamnt  +downstreamnt
atggcggacaacaaggaggccctcagggcgctcaagatcaagaccggtgtcatgacccgc
gtcaggaaggagctcgccatgtacgagcaggaggtgaagacggagacggagaagctcgaa
gccatgaaggccgaaggcagggacccgcacgacgtcaagcagcaggaccaggtgctcggg
gagtcgaccatgatgataggagactgcaaatcgaggatggagagcgcgttcaacgacctc
ctcgcggcggtggaggaacacggcccggactgcgagggcagcgaggaactcaccgcggcg
aaggccatcctggacgaggtcgagcccacgctcgaggtgtga

DBGET integrated database retrieval system