KEGG   Micromonas commoda: MICPUN_66805Help
Entry
MICPUN_66805      CDS       T02695                                 

Definition
(RefSeq) predicted protein
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
mis  Micromonas commoda
Brite
KEGG Orthology (KO) [BR:mis00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mis01001]
    MICPUN_66805
   01009 Protein phosphatases and associated proteins [BR:mis01009]
    MICPUN_66805
Enzymes [BR:mis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MICPUN_66805
Protein kinases [BR:mis01001]
 Serine/threonine kinases: Other
  Wnk family
   MICPUN_66805
Protein phosphatases and associated proteins [BR:mis01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MICPUN_66805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal APH Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 8243255
NCBI-ProteinID: XP_002501564
JGI: MicpuN3_66805
UniProt: C1E534
Position
4:join(<1553611..1554486,1555123..>1555392)
Genome map
AA seq 382 aa AA seqDB search
SEEEKEEETKFVEWDPTGRFGRTTQLLGRGTYKNVYMAFDEEEGRDVAWNQVKVSGLPRE
EKQRLMTEVEILKSLDHKNIIKLYHSWIVTEKDEVSVNFITEACAQTLKKYAAKLKTNLD
LRAVKSWSRQILRGLDYLHSQSPPIVHRDLKCDNIFVNQNQGEVKIGDLGLAAMLDNNRT
KSVIGTPEFMAPELYDEDYDERVDIYSFGMCIIELVTHECPYSECRNPAQIFKRVTEGVK
PEALDKIIDADLRSFVLKCIAPINKRLTAKELMADPFLDKTAIKAQAKPKPTAAPEEGEA
REVRKKGGSLDFRVKGRILEDKTLRLRLKIGDASGHTRTVEFPFNTDSDSAYSVASEMVE
ELQLAQSDVRTIMNEIENEVKF
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
tccgaggaggagaaggaggaggagaccaaattcgtcgagtgggaccccaccggacgcttc
ggaaggaccacccagctgctcggccgcggcacgtacaagaatgtgtacatggccttcgac
gaggaggaggggcgggacgtggcgtggaaccaggtcaaggtgagcgggttaccgcgcgag
gagaagcagcggctgatgaccgaggttgagattctgaaatccctggaccacaagaacatc
atcaagctctaccacagctggatcgtcacggagaaggacgaggtgagcgtcaactttatc
accgaggcgtgcgcgcagacgctgaagaagtacgcggccaagctcaagaccaacctggat
ctgcgggcggtcaagtcgtggtcccggcagatcctgcggggcctagactacctgcactcg
caatccccgcccatcgtgcaccgcgacctgaagtgcgacaacatctttgtcaaccagaac
cagggcgaggtgaagattggggacctcggtctggccgccatgctggacaacaacaggacc
aagtcggtgatcggcaccccggagttcatggcgcccgaactgtacgacgaggactacgac
gagagggtggacatctactcgttcggaatgtgcatcatcgagctggtcacgcacgagtgc
ccgtacagcgagtgccgtaaccccgcgcagatcttcaagcgcgtaaccgagggcgtcaaa
cccgaggcgctcgacaagataatcgacgcggacctccgatcgttcgtgctcaagtgcatc
gctcccatcaacaagaggctgacggcgaaggagctgatggcggatcccttcctggacaag
acggcgatcaaggcgcaggccaagcccaagccaaccgcggcgcccgaagagggcgaggcg
agggaggttaggaagaagggcggttcgctcgacttccgggtcaagggtcgcatcctcgag
gataagacgctcaggcttcgcctcaagattggcgacgcctcgggccacacccgcacggtt
gagtttcccttcaacacggactcggacagcgcgtactcggtggcgagcgagatggtggag
gagcttcagctcgcccagagcgacgttcggaccatcatgaacgagatcgagaacgaggtc
aagttc

DBGET integrated database retrieval system