KEGG   Micromonas commoda: MICPUN_85283Help
Entry
MICPUN_85283      CDS       T02695                                 

Definition
(RefSeq) predicted protein
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
mis  Micromonas commoda
Brite
KEGG Orthology (KO) [BR:mis00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mis01001]
    MICPUN_85283
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mis03036]
    MICPUN_85283
Enzymes [BR:mis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     MICPUN_85283
Protein kinases [BR:mis01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   MICPUN_85283
Chromosome and associated proteins [BR:mis03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     MICPUN_85283
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    MICPUN_85283
  Sister chromatid separation proteins
   Polo kinases
    MICPUN_85283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Kinase-like Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 8246270
NCBI-ProteinID: XP_002504728
JGI: MicpuN3_85283
UniProt: C1ECY6
Position
9:complement(join(1104673..1104951,1105060..1105210,1105349..1105616,1105986..1106515,1106678..>1107072))
Genome map
AA seq 540 aa AA seqDB search
RTYVRGRPLGKGGFAVVYGMQDPSTGENFAAKVVAKSTLEKERARAKILTEIRIHRGCDN
AHVVRFVRCFEDAANVYILMELCSNRTLADVVKARGRLTEPECAAYAREIVTAVAHLHAH
RVIHRDLKLGNLVATGGRLKIGDFGLACRVESDDERKTTICGTPNYIAPEVLAGSKGGGH
SYEVDVWSIGVIIYTLLVGTPPFQTSDVHATYKRIRANAYEFPEGVVNEGARELIRRCLA
PKPGDRPKIAEIATHPLLNAGWRGATPWSMPTPRVDMDKMERSTRSGGGAGGVDAAKKPR
APLSSSAGVATSAPIDPAEFATLGMDSPTTTAGGVHPVGSGASAAASGSNAPGNASLEAF
PPLWVTRWVDYTSKYGLGYVLSDGTFGVVFNDATKMTQRQPGAASTERRVAPPPVCFRAS
TPCPPGLEKKVKLMRHFRGYLSSDGRSAGAVEGAVAHLPHVKNWLRTKHAVLFRLSNRTI
QVCFQDGSEVLLSSEASACVFTSKSGTRTCHSLGALPQDPELLRRLRYVKEVLHQLVSRA
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
cgcacgtacgttcggggcaggccgctcggcaagggcggattcgcggtggtgtacggcatg
caggatccctccacgggggaaaacttcgcggcgaaggtggtcgcgaagagcacgctcgag
aaggaacgcgcgagggcgaagatcctcaccgagattcgcatccaccgcggatgcgacaac
gcgcacgtcgtccgattcgtccgatgcttcgaggatgccgcaaacgtgtacatcctcatg
gagctctgcagcaaccgcacgctcgcggacgtggtcaaggccagagggcggctcaccgag
cccgagtgcgcggcgtacgcgcgcgagatcgtcacggccgtcgcgcacctccacgcgcac
agggtcatacacagggacctcaagctcggtaacctcgtcgccacgggcgggaggctcaag
attggcgatttcggcctcgcgtgccgcgtcgagagcgacgacgagcgcaagacgacgatt
tgcggcactcccaactacatcgcccccgaggttctcgccggctccaagggtggcgggcac
tcgtacgaggttgacgtgtggtccatcggcgtcatcatctacaccctgttggtgggcacc
ccgccgttccaaaccagcgacgtgcacgccacgtacaagcggataagggccaacgcgtac
gagtttcccgaaggcgtcgtgaacgaaggcgctcgcgagctcatccgccgatgcctcgcg
cccaagcccggggaccgaccgaagattgccgaaatcgcgacgcacccgctgctgaacgcg
gggtggcgcggcgcgacgccgtggtccatgccgacgccgcgcgtggacatggacaagatg
gagaggtcgacgaggtccggcggcggcgccggcggagtcgacgcggccaaaaagccgagg
gcgccgctatcgtcgtcggcgggtgtcgccacctcggctcccatcgatccggcggagttt
gccaccctcggcatggactcgccgacgacgacggcggggggggttcaccccgtggggtct
ggcgcgtccgccgccgcgtcggggagtaacgctccgggtaacgcttccctggaggcgttt
ccgccgttgtgggtcacccgatgggtggattacacgagcaagtacgggctggggtacgtg
ctctccgacggcaccttcggcgtggtgttcaacgacgcgacgaagatgacgcagcggcag
ccgggcgcggcgtccacggagaggcgcgtggcgccccctccggtgtgcttccgcgcgtcg
acgccgtgcccgccggggttggagaagaaggtgaagctgatgcggcacttccgcgggtac
ctgtcctcggacggtcggagcgcgggtgccgtcgagggtgccgtcgcgcaccttccgcac
gtcaagaactggctgcgcaccaagcacgcggtgctctttcgcctctcgaaccgcaccatc
caggtgtgcttccaggacggcagcgaggttttgctctcgtcggaggcgtccgcgtgcgtg
ttcacgagcaagagcgggacgcgaacgtgccactcgctcggcgcgctgccgcaggacccg
gagctgctcaggaggctgaggtacgtgaaggaggtgctgcaccagctggtgagccgcgcg
tga

DBGET integrated database retrieval system