KEGG   Mycobacterium intracellulare MOTT-02: OCO_08460Help
Entry
OCO_08460         CDS       T01754                                 

Definition
(GenBank) putative acyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00071  Fatty acid degradation
mit00280  Valine, leucine and isoleucine degradation
mit00281  Geraniol degradation
mit00310  Lysine degradation
mit00362  Benzoate degradation
mit00380  Tryptophan metabolism
mit00410  beta-Alanine metabolism
mit00640  Propanoate metabolism
mit00650  Butanoate metabolism
mit00903  Limonene and pinene degradation
mit00930  Caprolactam degradation
mit01040  Biosynthesis of unsaturated fatty acids
mit01100  Metabolic pathways
mit01110  Biosynthesis of secondary metabolites
mit01120  Microbial metabolism in diverse environments
mit01130  Biosynthesis of antibiotics
mit01200  Carbon metabolism
mit01212  Fatty acid metabolism
Module
mit_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    OCO_08460
   00650 Butanoate metabolism
    OCO_08460
  Lipid metabolism
   00071 Fatty acid degradation
    OCO_08460
   01040 Biosynthesis of unsaturated fatty acids
    OCO_08460
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCO_08460
   00310 Lysine degradation
    OCO_08460
   00380 Tryptophan metabolism
    OCO_08460
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OCO_08460
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OCO_08460
   00281 Geraniol degradation
    OCO_08460
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCO_08460
   00930 Caprolactam degradation
    OCO_08460
Enzymes [BR:mit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     OCO_08460
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     OCO_08460
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     OCO_08460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 AlaDh_PNT_C F420_oxidored UDPG_MGDP_dh_N NAD_binding_8 adh_short_C2
Motif
Other DBs
NCBI-ProteinID: AFC47210
Position
831174..833318
Genome map
AA seq 714 aa AA seqDB search
MAENTIAWDKDADGIVTLTLDDPTGSANVMNEHYSESMHNAVERLAAEKDSITGVVITSA
KKTFFAGGDLKGMINLGPENAGEAFDTVESVKRDLRALETLGKPVVAAINGAALGGGLEI
ALACHHRIAADVKGSVLGLPEVTLGLLPGGGGVTRTVRMFGIQKAFMEVLSQGTRFKPAK
AKEIGLVDELVGSVDELVPAAKAWIKANPDSHEQPWDKKGYKMPGGTPSSPALAGILPSF
PALLKKQLKGAPMPAPRAILDAAVEGAQVDFDTASRIESRYFTQLVTGQVAKNMIQAFFF
DLQHINGGGSRPDGIEPVKINKIGVLGAGMMGAGIAYVSAKAGFDVVLKDVDIEAAQKGK
GYSEKLEAKALQRGKTTEEKSKALLDRITPTADPADLAGVDFVIEAVFENQELKHKVFQE
IEDVVEPNALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDEA
LARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVAPASIEHAGSQAGYP
APPLQLSDELNLELMHKIAAATRKGVEDAGGTYEPHPAEAVVDKMIEIGRPSRLKGAGFY
EYVDGKRTRLWPGLQETFKSGSAEIPLQDMIDRMLFAEALETQKCLDEGVLTSTADANIG
SIMGIGFPPYTGGSAQFIVGYSGAGGTGKDAFVARAKELAAKYGERFLPPKSLS
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaacaccattgcgtgggataaggacgccgacggcatcgtcaccctgacgctt
gacgaccccaccgggtcggccaacgtgatgaacgagcactacagcgagtccatgcacaac
gccgtcgaacgccttgccgccgagaaggattcgatcaccggcgtggtgatcaccagcgcg
aagaagaccttcttcgccggtggtgacctgaagggcatgatcaacctcggccccgagaac
gccggcgaggcgttcgacaccgtcgagtcggtcaagcgcgacctgcgtgcgctggagacc
ctgggcaagccggtggtggccgccatcaacggcgccgcactgggcggcggcctggagatc
gcgctggcctgccaccaccggatcgccgccgacgtgaagggcagcgtcctgggtctgccc
gaggtgacgctgggcctgctgccgggcggcggcggggtgacccgcaccgtgcggatgttc
ggcatccagaaggcattcatggaggtgttgagccagggcacccgcttcaagccggcgaaa
gccaaggagatcggcctggtcgacgagctcgtcggctcggtcgacgaacttgtgccggcc
gccaaggcgtggatcaaggccaaccccgattcgcacgaacagccctgggacaaaaagggt
tacaagatgcccggcggcaccccgtccagccccgcgctggccggcatcctgccgtcgttc
ccggcgctgctcaagaagcaactcaagggcgccccgatgccggcgccgcgggccatcctt
gacgcggccgtcgagggcgcgcaggtggacttcgacacggccagccgcatcgaaagccgt
tacttcacgcagctggtcaccggccaggtcgccaagaacatgatccaggcgttcttcttc
gacctgcagcacatcaacggcggcggttcgcgccccgacggcatcgagccggtcaagatc
aacaagatcggtgtgctgggcgcgggcatgatgggcgccggcatcgcctacgtgtcggcc
aaggccggcttcgacgtggtgctcaaggacgtcgacatcgaggccgcccagaagggcaag
ggttactcggaaaagcttgaggccaaggcacttcagcgtggcaagaccaccgaggagaag
agcaaggcgctgctggaccgcatcacgccgactgccgaccccgccgacctggcgggcgtc
gacttcgtgatcgaggcggtgttcgagaaccaggaactcaagcacaaggtgttccaggag
atcgaggacgtcgtcgaacccaacgcgctgctcgggtcgaacacctccaccctgccgatc
accggtctggcgaccggcgtcaagcggcaggaggacttcatcggaatccacttcttctcg
ccggtcgacaagatgccgctggtggaaatcatcaagggcgagaagacttccgacgaggcc
ctggcccgggtgttcgactacacgctggcgatcggcaagacgccgatcgtggtcaacgac
agccgcgggtttttcaccagccgcgtgatcggcacgttcgtgaacgaggcgctggcgatg
ctcggcgagggcgtggccccggccagcatcgagcacgccggttcgcaggccggctacccg
gcgccgccgctgcagctgtccgacgagctcaacctggagctgatgcacaagatcgccgcg
gccacccgcaagggcgtcgaggacgcgggcggcacctacgagccgcacccggccgaggcc
gtcgtcgacaagatgatcgaaatcggacggcccagccgcttgaagggcgccggcttctac
gagtacgtggacggcaagcggacccgcctgtggcccggcctgcaggagacgttcaagtcg
ggcagcgcggagattccgttgcaggacatgatcgatcgcatgctgttcgccgaggcgctc
gagacgcagaagtgtctggacgagggcgtgctgacctcgaccgccgacgccaacatcggc
tcgatcatgggcatcggcttcccgccgtacaccggtggtagcgcgcagttcatcgtcggt
tactccggtgccggcggcacgggcaaggatgcgttcgtggcccgcgccaaggaactggcg
gccaagtacggcgagcggttcctgccgccgaagtcactgagttaa

DBGET integrated database retrieval system