KEGG   Mycobacterium intracellulare MOTT-02: OCO_20410Help
Entry
OCO_20410         CDS       T01754                                 

Definition
(GenBank) acyl-CoA oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00071  Fatty acid degradation
mit00592  alpha-Linolenic acid metabolism
mit01040  Biosynthesis of unsaturated fatty acids
mit01100  Metabolic pathways
mit01110  Biosynthesis of secondary metabolites
mit01212  Fatty acid metabolism
Module
mit_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mit00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OCO_20410
   00592 alpha-Linolenic acid metabolism
    OCO_20410
   01040 Biosynthesis of unsaturated fatty acids
    OCO_20410
Enzymes [BR:mit01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     OCO_20410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-ProteinID: AFC48404
Position
complement(2112385..2114337)
Genome map
AA seq 650 aa AA seqDB search
MAPQKTSTAEHLRNALDGRWRDVRNRMRTTLTEDLFRPHYTPNTVIARTKVAEQMRIMAA
FGAAADSFRKEHGGTGDVGAAITMIEMLAMSDLSLMVKAGVQWGLFGGAVENLGTERHHE
TYVPKIISLELRGCFAMTETGHGSDVQSLETTATYDAETQEFVIDSPTPSARKDYIGGAA
ETATMAAVFAQLITTEDGKPVNHGVHCVLVPIRDEDGNDLPGITTSDCEYKGGLPGVDNG
RIVFDHVRVPRVNLLNKYGDVAPDGTYSSPIENPNRRFFTMLGTLVRGRITVGGSAGAAG
RVALDIATRYALQRRQFSAPDDGSEVLIMDYLVHQRRLFPLIAKSYALQFAQNELVSKCH
DVQSADAPDADEQRELEARAAGLKAANTWHASRAIQESREACGGAGYMAENRLIGLRGDT
DVFTTFEGDNHVLTQLVAKELLTAYADDIKSMSPVEWVRFAANTVGERVIKRTAAEAIIQ
TIVDSRQDSEEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHV
LHAASAHIDRVVLEAFVAGIDGCANEEARELLGILCDLYALSVIEDDKAWYIEHRYLSTE
RAKAVTRGINDRCRALRPHAATLVDGFGVPEQLRYAEMLHPENLADAVTS
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggcgccacaaaagacaagcaccgcagaacatctccgcaacgcgctggacggccggtgg
cgtgacgtcagaaaccggatgcggacgacgctgaccgaggacctgttccgcccgcactac
acccccaacacggtgatcgcccgcaccaaggtggcggagcagatgaggatcatggcggcg
ttcggcgcggccgccgacagcttccgcaaagaacatggcggcaccggcgacgtcggcgcg
gcgatcacgatgatcgagatgctggcgatgtcggacctctcgctgatggtgaaggccggg
gtgcagtgggggctgttcggcggtgccgtggagaacctgggcaccgagcgccaccacgag
acctacgtgcccaagatcatcagcctggaattgcgcggctgtttcgcgatgaccgagacc
gggcacggcagcgacgtgcagtcgctggagaccaccgcgacctacgacgccgagacgcag
gagttcgtcatcgactcccccaccccgtcggcgcgcaaggactacatcgggggcgcggcc
gaaaccgcaaccatggcagcggttttcgcgcaactgatcaccaccgaggacggcaagccg
gtcaatcacggcgtgcactgcgtgctggtcccgatccgcgacgaggacggcaacgacctg
cccgggatcaccacgtcggactgcgaatacaagggcgggctgcccggggtggacaacggc
cgcatcgtgttcgaccacgttcgcgtcccgcgggtgaacctgttgaacaagtacggcgat
gtcgcccccgacggcacctacagctcgccgatcgagaaccccaaccgccggttcttcacc
atgctgggcactttggtgcgcggccggatcaccgtgggcggcagcgccggcgccgccggc
cgggtggcgctggacatcgcgacccggtatgcgttgcagcgcaggcagttcagcgccccc
gacgacggttccgaggtgctgatcatggactacctggtgcaccagcggcggctgttcccg
ctgatcgcgaagtcctacgccctgcagttcgcgcagaacgaactggtcagcaaatgtcat
gacgtccagagcgccgacgcacccgacgccgacgagcaacgcgagctcgaagcccgcgcg
gccgggctaaaggccgccaacacctggcatgccagccgcgcgatccaggaatcccgcgag
gcgtgcggcggcgcgggctacatggccgagaacaggttgatcgggctgcgcggtgacacc
gacgtcttcaccacgttcgagggcgacaatcacgtgctgacccagctggtggccaaggaa
ctgctgaccgcgtacgccgacgacatcaagagcatgagcccggtcgaatgggtgcgcttt
gccgccaacaccgtcggtgaacgcgtcatcaaacgcactgcggcggaagcgattatccaa
acgatcgtggactcccgccaggacagcgaggaagagggcagcctgttcaatcgcggcacg
cagatcaagatgttcgaagaccgcgaggaatacctgctggcgtcggtggcgcgccggctg
caggcgaaatccaaagagatgtcggaattcgacgcgttcaactcggtgcaggaccacgtg
ctgcacgcggcgagcgcccacatcgaccgcgtggtgctcgaagcgttcgtcgccgggatc
gacggctgcgcgaacgaggaggcccgcgagctgttggggatcctgtgcgacctgtacgcg
ttgtcggtgatcgaggacgacaaggcgtggtacatcgagcaccggtacctgtccaccgag
cgcgccaaggccgtcacgcggggaatcaacgaccgctgccgggcgctgcgcccgcacgcc
gcgacactggtcgacggcttcggggttcccgagcaactgcgttacgccgagatgctgcac
ccggagaacttggcggacgccgtcacaagctga

DBGET integrated database retrieval system