KEGG   Mycobacterium intracellulare MOTT-02: OCO_26870Help
Entry
OCO_26870         CDS       T01754                                 

Definition
(GenBank) adhA_1
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00010  Glycolysis / Gluconeogenesis
mit00071  Fatty acid degradation
mit00350  Tyrosine metabolism
mit00625  Chloroalkane and chloroalkene degradation
mit00626  Naphthalene degradation
mit01100  Metabolic pathways
mit01110  Biosynthesis of secondary metabolites
mit01120  Microbial metabolism in diverse environments
mit01130  Biosynthesis of antibiotics
mit01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCO_26870
  Lipid metabolism
   00071 Fatty acid degradation
    OCO_26870
  Amino acid metabolism
   00350 Tyrosine metabolism
    OCO_26870
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OCO_26870
   00626 Naphthalene degradation
    OCO_26870
Enzymes [BR:mit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     OCO_26870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AFC49050
Position
complement(2807160..2808188)
Genome map
AA seq 342 aa AA seqDB search
MASPVTTTAMRAWRVRRPGPMDTGPLEQVTTEVPRPGPSELLVAVRACGVCRTDLHVTEG
DLPVHRERVTPGHEVVGEVVELGAEAGDEFRVGDRVGIAWLRHTCGVCKYCRRGDENLCP
KSRYTGWDADGGYAEFATVPAAFAHPLPGGYSDSELAPLLCAGIIGYRSLLRAELPPGGR
LGLYGFGGSAHITAQVALAQGAEVHVMTRGARARELALELGAASAQGAADPPPAPLDAAI
LFAPVGDLVLPALQALDRGGTLAIAGIHLSDIPALNYQRHLFQERQVRSVTSNTRADARA
FLDFAGEHHIEVTTPEYPLGQADRALTDLSAGRIAGAAVLLV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaccggtgaccaccacggcaatgcgcgcctggcgcgttcgtcgacccgggccg
atggataccggcccgctcgagcaggtcaccaccgaggtgccgcggccgggtccgtccgaa
ctgctggtggccgtgcgagcgtgcggggtgtgccggaccgacctgcacgtcaccgaaggc
gaccttcccgtccaccgcgagcgtgtcacgcccgggcacgaggtggtgggggaggtcgtc
gaactcggcgccgaggccggcgacgagttccgggtgggggaccgggtgggtatcgcctgg
ctgcgccacacctgtggcgtgtgcaagtactgccgccgcggcgacgagaacctctgcccg
aaatcccgctacaccggctgggacgccgacggcggctacgccgaattcgccaccgtcccg
gccgctttcgcgcaccccctgcccggcgggtacagcgacagcgaactcgcaccgttgttg
tgcgcgggcatcatcggttaccgctcgctgcttcgcgccgagctgccgcccggcgggcgg
ctgggcctctacggtttcggcggcagcgcgcacatcaccgcgcaggtcgccctcgcgcag
ggcgcagaggtgcacgtgatgacccgcggagcgcgggcccgcgagctggcgttggaactc
ggcgccgcatccgcacaaggcgcggcggatccgcccccggcgccactggacgccgcgatc
ctgttcgctcccgtcggtgatctggtgctgcccgcgctgcaggcgctggatcgcggtggc
acgctggcgatcgccgggatccacctctcggatatcccggcgctgaactaccagcgtcac
ctgtttcaggaacgccaggtccggtcggtcacctccaacacccgggccgacgcgcgggcc
ttcctcgatttcgcgggcgagcaccacatcgaggtgaccacgcccgaatatcctctcgga
caagccgatcgggcgttgacggatctgagcgccgggcgcatcgcgggcgcggcggtgctg
ctggtgtga

DBGET integrated database retrieval system