KEGG   Mycobacterium intracellulare MOTT-02: OCO_37660Help
Entry
OCO_37660         CDS       T01754                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00071  Fatty acid degradation
mit00072  Synthesis and degradation of ketone bodies
mit00280  Valine, leucine and isoleucine degradation
mit00310  Lysine degradation
mit00362  Benzoate degradation
mit00380  Tryptophan metabolism
mit00620  Pyruvate metabolism
mit00630  Glyoxylate and dicarboxylate metabolism
mit00640  Propanoate metabolism
mit00650  Butanoate metabolism
mit00900  Terpenoid backbone biosynthesis
mit01100  Metabolic pathways
mit01110  Biosynthesis of secondary metabolites
mit01120  Microbial metabolism in diverse environments
mit01130  Biosynthesis of antibiotics
mit01200  Carbon metabolism
mit01212  Fatty acid metabolism
mit02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCO_37660
   00630 Glyoxylate and dicarboxylate metabolism
    OCO_37660
   00640 Propanoate metabolism
    OCO_37660
   00650 Butanoate metabolism
    OCO_37660
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OCO_37660
   00072 Synthesis and degradation of ketone bodies
    OCO_37660
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCO_37660
   00310 Lysine degradation
    OCO_37660
   00380 Tryptophan metabolism
    OCO_37660
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OCO_37660
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCO_37660
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OCO_37660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mit04147]
    OCO_37660
Enzymes [BR:mit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OCO_37660
Exosome [BR:mit04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCO_37660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFC50129
Position
4000785..4001933
Genome map
AA seq 382 aa AA seqDB search
MHPQALLARCLTALAERTDFDPVDVDDVIAGNGILSGDHGDDIARMSVLLAGWPETVPGM
TLSRFCGSGQQAVTVAAAGIAAGSEDLVIAGGVESMSRWGVTAGVPTIDGNNPDLRAVYP
TVPQGISADLIATLEGFGREVVDAYAVQSQSRAAVAIEERRFDRSLVDVAAPAGRVECDE
HPRPGTTAETLSRLTPAFEAMGAARADGEQRTFDEICLERYPGVDRIDHVHHAGNSSGVV
DGAAAVLLASSNWMHTHRVTPRAQIRATAAIGSEPIIMLTAPGPAAQRCLERAGMTVADI
DLWEINEAFAAVPLKTMRDLDIDPDVVNVNGGAIALGHPIGATGAMLIGTVLDELERRDL
TTGLVTMCTGGGMGTATIIERV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgcacccgcaggccttgctcgcgcgctgcctcaccgcactggccgagcggaccgacttc
gatccggtcgacgtcgatgacgtgatcgccggcaacggcatcctcagcggggaccacggc
gacgacatcgcccgaatgtccgttctgttggcggggtggccggagaccgtgccggggatg
acgttgagccggttctgcggctcgggccagcaggccgtcaccgttgcggcggcgggcatc
gccgccggcagtgaggatttggtgatcgccggcggtgtcgagtcgatgtcgcggtggggg
gtgacggccggggtcccgacgatcgacggcaacaatcccgatcttcgcgcagtgtacccg
actgtgccacaaggcatttcggccgatctgatcgcgaccctggagggattcggccgcgag
gtcgtcgacgcctacgccgtgcagagccagagccgcgccgccgtggccatcgaggagcgg
cgcttcgatcgttccctggtcgacgtggccgcacccgccggccgcgtggaatgcgacgag
catccgcgcccgggcaccaccgccgagacgctgtcacgcctcacaccggccttcgaggcg
atgggggccgcgcgcgccgacggcgagcaacgcacgttcgacgagatttgcctcgagcgc
tatcccggcgtcgaccgcatcgatcacgtgcaccacgcgggcaattcgtccggcgtggtc
gacggcgccgccgccgtgctgctcgcctcctccaactggatgcacacccaccgcgtgacc
ccgcgggcgcagatccgggcgaccgcggccatcggcagcgaaccgatcatcatgctcacc
gcgcccggccccgcggcgcagcggtgcctggaacgcgccggcatgacggtggccgacatc
gatctgtgggagatcaacgaggccttcgccgcggttccgctcaagacgatgcgcgatctg
gacatcgatcccgacgtggtcaacgtcaacggcggcgcgatcgccctcgggcacccgatc
ggcgccaccggcgccatgctgatcggcaccgttctcgacgaactcgaacgtcgtgacctg
acaacgggactggtgaccatgtgcacgggcggcgggatgggcacggcgacgatcatcgag
cgggtgtga

DBGET integrated database retrieval system