KEGG   Mycobacterium intracellulare MOTT-02: OCO_43110Help
Entry
OCO_43110         CDS       T01754                                 

Definition
(GenBank) hypothetical protein
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00340  Histidine metabolism
mit00350  Tyrosine metabolism
mit00360  Phenylalanine metabolism
mit00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mit00401  Novobiocin biosynthesis
mit01100  Metabolic pathways
mit01110  Biosynthesis of secondary metabolites
mit01130  Biosynthesis of antibiotics
mit01230  Biosynthesis of amino acids
Module
mit_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mit00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    OCO_43110
   00350 Tyrosine metabolism
    OCO_43110
   00360 Phenylalanine metabolism
    OCO_43110
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCO_43110
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    OCO_43110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mit01007]
    OCO_43110
Enzymes [BR:mit01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     OCO_43110
Amino acid related enzymes [BR:mit01007]
 Aminotransferase (transaminase)
  Class II
   OCO_43110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AFC50674
Position
complement(4545455..4546510)
Genome map
AA seq 351 aa AA seqDB search
MHAVPAPVAGQICDALPDAVDPFALSLNENPFPPLPSVRSALIRSVSAANRYPEFLPERL
RGLIAGHIGVPTERVVLGAGATGVVLQALQALTAPGDTIAMASPTFDGYPIVAQLARLNS
SFVPLDAHGQHDLDALAEAAGAARVVVVCRPHNPTGTLEPAAAVLRFLRRVPRDTVVLLD
EAYIEFTAPEHRFDVAALVTRFPNVVVVRTFSKAYGLAGLRIGYAVASHQLAPTLWTQQL
PFGIAITGLLAVGASYAAEGELLRRIRLITAERRYLRMRLSALGIYTTDAHANFMYLPSQ
QGLSWREAFGDDAPRVRYYADGAARITVGGRASTTAVLSALGKATLGLQVR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcggttccggccccggttgccggccagatctgcgatgcgctgcccgacgcggtg
gatccgttcgccttgtcgctcaacgagaatccgtttccgccgctaccgtcggtgcgttcg
gcgttgattcggtccgtttccgcggcgaaccggtatccggagttcttgccggagcggttg
cgcggcttgatcgccggccacatcggtgtgcccaccgagcgggtggtgctgggcgccggg
gcgacgggcgtcgtgttgcaggcgctgcaggcgctgaccgcgccgggcgacacgatcgcc
atggcgtcgccgacgttcgatggctatccgatcgtcgcgcaactggcacgattgaactcg
tcgttcgttccgctggacgcgcacggccagcacgacctcgacgcgctggccgaggccgcc
ggcgccgcccgcgtggtggtggtgtgccggccgcacaatccgaccggcacgctggagccc
gcggccgccgttctccggttcctgcgccgggtgccgcgcgacaccgtcgtgctgctcgac
gaggcttatatcgagttcaccgctcccgagcaccgtttcgacgtggcggcactggtcacg
cgttttcccaacgtcgtggtggtgcggaccttctccaaagcctacggcctggcagggctg
cgaatcggttacgcggtggcgtcccaccagctggcgccgacgctgtggacccagcagctg
ccgttcggcatcgcgatcaccggcctgctcgcggtcggggcgtcgtatgccgcggaaggt
gaactgctgcgccggatccggctgatcaccgccgaacgccgctatctccggatgcgcctg
agcgcgctggggatctacacgaccgacgcgcacgcgaacttcatgtatctgccgtctcaa
cagggcttgtcgtggcgtgaggctttcggcgacgacgctccacgcgtgcggtattacgcg
gacggtgccgcgcggatcaccgtgggcggccgcgcatcgacgacggcggtgctgtcggcg
ttgggaaaggccacgctcgggctccaagtgcggtaa

DBGET integrated database retrieval system