KEGG   Mycobacterium intracellulare MOTT-02: OCO_50310Help
Entry
OCO_50310         CDS       T01754                                 

Definition
(GenBank) hypothetical protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00010  Glycolysis / Gluconeogenesis
mit00053  Ascorbate and aldarate metabolism
mit00071  Fatty acid degradation
mit00280  Valine, leucine and isoleucine degradation
mit00310  Lysine degradation
mit00330  Arginine and proline metabolism
mit00340  Histidine metabolism
mit00380  Tryptophan metabolism
mit00410  beta-Alanine metabolism
mit00561  Glycerolipid metabolism
mit00620  Pyruvate metabolism
mit00625  Chloroalkane and chloroalkene degradation
mit00903  Limonene and pinene degradation
mit01100  Metabolic pathways
mit01110  Biosynthesis of secondary metabolites
mit01120  Microbial metabolism in diverse environments
mit01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCO_50310
   00053 Ascorbate and aldarate metabolism
    OCO_50310
   00620 Pyruvate metabolism
    OCO_50310
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OCO_50310
   00561 Glycerolipid metabolism
    OCO_50310
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCO_50310
   00310 Lysine degradation
    OCO_50310
   00330 Arginine and proline metabolism
    OCO_50310
   00340 Histidine metabolism
    OCO_50310
   00380 Tryptophan metabolism
    OCO_50310
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OCO_50310
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OCO_50310
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OCO_50310
Enzymes [BR:mit01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     OCO_50310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFC51393
Position
complement(5273432..5274862)
Genome map
AA seq 476 aa AA seqDB search
MREYLKFYIDGRWVDPVRPNPFEVENPATEQVSGKISLGSAADVDVAVQAARRAFAGWSL
STREQRLDLLQSILAEYQKRADDLAEAVTEEIGAPPSLAAGPQVFLGIGHLTTAIDVLKN
FPFSEHKGETLIAKEPIGVCGLITPWNWPINQVAVKVYPALATGCTVVLKPSEVAPYSPY
IFAEILAAAGVPAGVFNLVNGDGAGVGAALASHPDIDMVSFTGSTRAGIEVAKNAAPTVK
RVTQELGGKSPNIVLDDGGFADGVRAGVANMMPNSGQSCNAPSRMLVPNSRMAEAITIAR
EVAEQVKVGSADDATAIGPVASRTQFEKVQRLIQQGIDEGATVVAGGPGRPAGLDTGYYV
KPTVFAHVTNDMTIAREEIFGPVLCILGYDDIDQAVEIANDTEYGLAGYVSGADLDTARE
VARRIRAGWVTINHAFDMNAPFGGYKRSGNGREWSEFGFHEYLEVKSTLGYAPGKA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaatacctgaagttctacatcgacggacgatgggtcgacccggtgcggcccaac
cccttcgaggtggaaaacccggcgaccgagcaggtttcgggaaagatctcgctggggtcg
gcggccgacgtcgacgtggcggttcaggccgcccggcgcgccttcgcgggctggtcgctg
agcacccgcgaacagcgcctggacctgttgcagtccatcctcgccgaataccagaagcgg
gccgacgatctcgccgaggcggtcaccgaggagatcggcgcgccgccctcactggccgcg
ggcccgcaggtcttcctcggcatcggccacctcacgacggccatcgacgtgctgaagaac
ttcccgttctccgaacacaaaggggagaccctgatcgccaaggagccgatcggtgtctgc
ggcttgatcacgccgtggaactggccgatcaaccaggtcgccgtcaaggtgtatccggcg
ctggccaccggctgcaccgtcgtcctgaaaccctctgaggtcgcgccgtattcgccgtac
atcttcgccgagatcctggccgccgcgggcgtgccggccggggtgttcaatctggtcaac
ggtgacggcgcgggcgtgggcgcggcgctggcgagccatcccgacatcgacatggtgtcg
ttcaccgggtccacccgcgccggcatcgaggtcgccaagaacgccgccccgacggtgaag
cgagtgacccaggaactcggcggcaagagccccaacatcgtcctcgacgatggcggcttc
gccgacggcgtccgcgcgggcgtggccaacatgatgcccaactccgggcagagctgtaac
gcgccgtcgcgcatgctggtgccgaattcacggatggccgaggccattacgatcgcgcgc
gaggtggccgaacaggtcaaggtgggcagcgccgacgacgcgacggcgatcgggccggtg
gcgtcgaggacgcagttcgagaaggtgcagcggctgatccagcagggcatcgacgagggc
gcgaccgtggtcgcgggcggcccgggccgaccggcggggctggacacggggtactacgtc
aagccgacagtcttcgcgcatgtcaccaacgacatgacgatcgcgcgcgaggagatcttc
gggccggtgctgtgcatcctcggctacgacgacatcgaccaggccgtcgagatcgccaac
gacaccgagtacggcctcgccggctatgtctccggggccgacctcgacacggcgcgcgag
gttgcccgccggatccgcgcgggatgggtgacgatcaatcacgcgttcgacatgaacgcg
ccgttcggcggctacaagcgcagcggcaacggccgcgaatggagcgaattcggcttccac
gagtacctggaggtcaagagcaccctgggctacgcgcccggcaaggcctga

DBGET integrated database retrieval system