KEGG   Mitsuaria sp. 7: ABE85_01865Help
Entry
ABE85_01865       CDS       T04402                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
miu  Mitsuaria sp. 7
Pathway
miu00790  Folate biosynthesis
miu01100  Metabolic pathways
miu02020  Two-component system
Module
miu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:miu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABE85_01865
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABE85_01865
Enzymes [BR:miu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ABE85_01865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N TAT_signal Metallophos
Motif
Other DBs
NCBI-ProteinID: ANH66618
UniProt: A0A1A9HHS5
Position
complement(397568..399157)
Genome map
AA seq 529 aa AA seqDB search
MDRRRFLHASTVLGGASLLTLPGAHAQAPAVITRDAMRPQMPHGIQSGDPIADGAIVWTR
GDRPSRLWLEWSTTASFANLQRVRGPHLLEDSDFTGRIDLRGLPAGQEIFYRVVLQDLHN
ERVLSEPVAGHLRLPAAFGAKGVRDVRFAWSGDTCGQGWGINEQWGGMKIYEQIRRINPD
FFLHSGDTIYADSPIPAEIKLPDGSLWRNVVTEQTSKVAETLDEYRGRYRYNLMDANVRR
MSADVPQIWQWDDHEVTNNYSDSKDLSGDARYTEKNIPLLVARATKAFQEYAPMRRFGDV
EGERIYRHLPQGPLLDVFVVDMRSYRGPNSANLQTEENADSAFMGRPQIAWLLEGLKRSK
AVWKVIAADMPIGLHVNDGKDAEGRDKWEAIANGDDGAPRGRELEIARLLSEIKRHQLHN
IVWLTADVHYTAAHFFDPAKAKHTDFLPFWEFVSGPLHAGGFGPNKADGTFGMQVAYQKG
PGIANAAPAPDTQFFGQVDIDAKTRAMTVTLKDLEGSTLYKKTLEPKRA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggaccgccgccgcttcctccacgccagcaccgttcttggaggcgcctcgctgctgacg
ctgcccggcgcgcatgcgcaggcccccgccgtcatcacgcgcgacgcgatgcggccgcag
atgccgcacggcatccagtccggcgatccgatcgccgacggcgccatcgtctggacccgc
ggcgatcgcccgagccgcctctggctcgagtggtccaccaccgccagcttcgccaacctg
cagcgcgtgcgcggaccgcatctgctcgaagactccgacttcaccggccgcatcgacctg
cgcggcctgcccgccggccaggagatcttctatcgcgtcgtcctgcaggacctgcacaac
gagcgcgtactctccgagcccgttgccggacatctgcgcctgcccgccgccttcggcgcc
aagggcgtgcgcgacgtccgcttcgcctggagcggggacacctgcggccagggctggggc
atcaacgagcaatggggcggcatgaagatctatgagcagatccgccgcatcaaccccgac
ttcttcctgcacagcggcgacaccatctacgccgacagccccatccccgccgagatcaag
ctccccgacggatcgctctggcgcaacgtcgtcaccgagcagaccagcaaggtcgccgag
acgctcgacgagtaccgcggccgctaccgctacaacctgatggacgccaacgtgcgccgc
atgtcggccgacgtgccgcagatctggcagtgggacgaccacgaggtcaccaacaactac
tccgacagcaaggacctctccggcgacgcccgctacaccgagaagaacatcccgctgctc
gtcgcccgcgccaccaaggccttccaggaatacgcgccgatgcgccgcttcggcgacgtc
gagggcgagcgcatctaccgccatctgccgcaggggccgctgctcgacgtcttcgtcgtc
gacatgcgcagctaccgcggccccaacagcgccaacctccagaccgaggagaacgccgac
agcgccttcatgggccgtccgcagatcgcgtggctgctcgagggattgaagcgctcgaag
gcggtctggaaggtcatcgccgccgacatgccgatcggcctgcacgtcaacgacggcaag
gacgccgagggtcgcgacaaatgggaagcgatcgccaacggcgacgacggcgcgccgcgc
ggccgggaactggaaatcgcccggctcctcagcgagatcaagcgccatcagttgcacaac
atcgtctggctcaccgccgacgtgcactacaccgccgcgcacttcttcgatcccgccaag
gcgaagcacaccgacttcctgcccttttgggaattcgtctccggcccgttgcacgcgggc
ggtttcggtcccaacaaggccgacggcaccttcggcatgcaggtcgcgtatcagaagggg
ccaggcattgccaatgctgctcccgcgcccgacacgcagttcttcggccaggtggatatc
gacgccaagacgcgcgcgatgacggtcacgctcaaggatctggagggttcgacgctctac
aagaagaccttggagccgaagcgagcctga

DBGET integrated database retrieval system