KEGG   Mitsuaria sp. 7: ABE85_05930Help
Entry
ABE85_05930       CDS       T04402                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
miu  Mitsuaria sp. 7
Pathway
miu00030  Pentose phosphate pathway
miu01100  Metabolic pathways
miu01120  Microbial metabolism in diverse environments
miu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:miu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ABE85_05930
Enzymes [BR:miu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     ABE85_05930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 Epimerase 3HCDH_N DUF460
Motif
Other DBs
NCBI-ProteinID: ANH70304
UniProt: A0A1A9HQU2
Position
1343797..1344600
Genome map
AA seq 267 aa AA seqDB search
MEQRLEQQVALVTGASSGIGKGIAVAMAEAGAAVIVNYHSQPDAAKEVVEHITRSGGRAI
AVKADVGSEPEVEQLFEKAVEAFGRVDILVANSGIQRDAPIGEMTLDQWNEVIATNLTGQ
FLCARAAVRLFRRQGRDEARSRALGKIIHISSVHQLIPWAGHANYAASKGGIDLFMRSLA
QEVAQEGIRVNAIAPGAIATAINRESVEDDTARKKMLSLIPYGRIGAPEDVAAAALWLAS
DASDYVVGTTLFIDGGMSLYPEFRDGG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ctggagcaacggctggagcaacaggtggccctcgtcaccggggcgagttcgggcatcggc
aagggcatcgccgtcgcgatggccgaggccggcgcggccgtcatcgtcaactaccactcg
cagccggatgcggccaaggaggtggtcgagcacatcacacgatccggcggccgcgcgatc
gcggtgaaggccgatgtcggctcggagcccgaggtcgaacagctgttcgagaaggcggtc
gaggcgttcggtcgggtcgacatcctcgtggccaactccggcatccagcgcgatgcgccc
atcggtgagatgacgctcgatcagtggaacgaggtgatcgccaccaacctcaccggacag
ttcctctgcgcgcgcgcggcggtccgcctgttccgtcgacagggccgggatgaagcgcgc
tcacgcgcgctgggcaagatcatccacatcagctccgtccaccagctcatcccgtgggcc
ggccatgcgaactacgcggcgtccaagggcggcatcgacctgttcatgcgcagccttgcg
caggaggtggcgcaggagggcatccgggtcaacgccatcgcgcccggcgccatcgccacc
gccatcaaccgcgaatcggtcgaagacgacaccgcacggaagaagatgctgtccctcatc
ccctacggccgcatcggcgcgcccgaggacgtggccgccgccgcgttgtggctggcgagc
gatgcctcggactacgtggtcggcacgaccttgttcatcgacggggggatgagcctgtat
ccggagttccgggacgggggctga

DBGET integrated database retrieval system