KEGG   Mitsuaria sp. 7: ABE85_14080Help
Entry
ABE85_14080       CDS       T04402                                 

Definition
(GenBank) hypothetical protein
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
miu  Mitsuaria sp. 7
Pathway
miu00471  D-Glutamine and D-glutamate metabolism
miu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:miu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ABE85_14080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:miu01011]
    ABE85_14080
Enzymes [BR:miu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     ABE85_14080
Peptidoglycan biosynthesis and degradation proteins [BR:miu01011]
 Precursor biosynthesis
  Racemase
   ABE85_14080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: ANH70557
UniProt: A0A1A9HT75
Position
3219337..3220113
Genome map
AA seq 258 aa AA seqDB search
MGVFDSGVGGLTVLKALREQLPNVPLHYVADTAHAPYGDRSSEYIVERSVRVAERLRDVG
ARMAVVACNTATAHAVQAMRERWPDWPVVGIEPGVKPAVAATRNGRIGVMATTATIASRR
FEQLVAAHASDVELISQPCPGLVTLIERGDLRSAELGDLIERFCEPLRQRGVDTVLLGCT
HYPLVQSRIQAALGDGVQLLNIEDAVARQARRVWESLGPVASGPAAIVLESTGDPLPLQH
LAREALGWRDVTATRIAA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atcggggtcttcgattccggcgtcggcggactgaccgtgctgaaggcgctgcgcgagcag
ttgcccaatgtgccgctgcattacgtcgcggacacggcccacgcaccgtatggggacagg
agcagcgagtacatcgtcgagcgcagcgtgcgggtcgccgagcgcctgcgggacgtcggc
gcccggatggcggtcgtggcgtgcaatacggcgaccgcgcacgccgtccaggcgatgcgc
gaacgctggccggactggccggtcgtgggcatcgagccgggcgtgaaacccgccgtggcg
gcgacgcgtaacggccgcatcggggtgatggcgacgacggcgacgatcgcgagccggcgt
ttcgaacaactcgtcgcggcgcatgccagcgacgtcgaactgatcagccaaccctgcccc
ggcctcgtcacgctgatcgagcgcggcgatctgcgcagtgccgaactcggcgacctgatc
gagcgcttctgcgagccgctgcggcagcggggcgtcgacacggtgctgctcggctgcacc
cactacccgctggtgcagtcgcgcatccaggcggcgctcggcgacggcgtgcagttgctc
aacatcgaggacgccgtggcgcgtcaggccaggcgcgtgtgggaaagcctcggcccggtc
gcgtcagggcccgcggcgatcgtgctcgaaagcaccggcgatcccttgccgctgcagcat
ctggcgcgcgaggcgctcggctggcgcgacgtcacggcgacacgcatcgcggcctga

DBGET integrated database retrieval system