KEGG   Mitsuaria sp. 7: ABE85_14640Help
Entry
ABE85_14640       CDS       T04402                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
miu  Mitsuaria sp. 7
Pathway
miu00071  Fatty acid degradation
miu00072  Synthesis and degradation of ketone bodies
miu00280  Valine, leucine and isoleucine degradation
miu00310  Lysine degradation
miu00362  Benzoate degradation
miu00380  Tryptophan metabolism
miu00620  Pyruvate metabolism
miu00630  Glyoxylate and dicarboxylate metabolism
miu00640  Propanoate metabolism
miu00650  Butanoate metabolism
miu00900  Terpenoid backbone biosynthesis
miu01100  Metabolic pathways
miu01110  Biosynthesis of secondary metabolites
miu01120  Microbial metabolism in diverse environments
miu01130  Biosynthesis of antibiotics
miu01200  Carbon metabolism
miu01212  Fatty acid metabolism
miu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:miu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABE85_14640
   00630 Glyoxylate and dicarboxylate metabolism
    ABE85_14640
   00640 Propanoate metabolism
    ABE85_14640
   00650 Butanoate metabolism
    ABE85_14640
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABE85_14640
   00072 Synthesis and degradation of ketone bodies
    ABE85_14640
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABE85_14640
   00310 Lysine degradation
    ABE85_14640
   00380 Tryptophan metabolism
    ABE85_14640
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABE85_14640
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABE85_14640
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABE85_14640
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:miu04147]
    ABE85_14640
Enzymes [BR:miu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABE85_14640
Exosome [BR:miu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABE85_14640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANH68497
UniProt: A0A1A9HMF3
Position
complement(3345372..3346547)
Genome map
AA seq 391 aa AA seqDB search
MSKALIVSTARTPLAKSWKGSFNMSHGATLGGHVVRAALERAGIEGGEVEDVLMGCATPE
GATGGNIARQIALRAGLPVSVSGQTVNRFCSSGLQTIATAAQRIIAGEADVFVAGGVESI
SCVQNEANRHMGHESWLSAHKPEIYWSMLQTAENVAQRYKIPKERMDRYGAASQQRACAA
QAEGLFNAEIVPITVMAGVADKVRGMMTREVTVSVDEGLRVGTTYESIKDIRTAIPGGVV
TAGNASQFSDGAGACAIVSEDYAQRKGLKPLGRFLGFAVAGCEPDEMGIGPVFAVPKVLK
RLGLKVSDIDLWELNEAFAVQVLYCADKLGIPMDRLNVNGGAIAIGHPYGVSGQRLTGHA
LIEGKRRGAKRVCVTMCIGGGMGAAGVFEVL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcattgatcgtttccacggcccgcaccccgctcgccaagagctggaagggg
tcgttcaacatgagccacggcgcgacgctgggcggccacgtggtgcgcgcggcgctggag
cgcgcgggcatcgagggcggcgaggtcgaggacgtcctcatgggctgcgccacgcccgag
ggcgccaccggcggcaacatcgcgcgccagatcgcgctgcgcgccggcctgccggtgagc
gtctccggacagaccgtcaaccggttctgctccagcggcctgcagaccatcgcgaccgcg
gcgcagcgcatcatcgcgggcgaggccgacgtcttcgtcgccggcggcgtggagagcatc
tcctgcgtccagaacgaggccaaccgccacatgggccacgagagctggctgtcggcgcac
aagcccgagatctactggtccatgctgcagacggccgagaacgtcgcccagcgctacaag
atccccaaggagcgcatggaccgctacggcgcggccagccagcagcgcgcctgcgccgcg
caggccgaaggcctgttcaacgccgagatcgtgcccatcaccgtgatggccggcgtcgcc
gacaaggtgcgcggcatgatgacgcgggaagtcaccgtcagcgtcgatgaaggcctgcgc
gtgggcaccacctacgagagcatcaaggacatccgaacggccatccccggcggcgtggtc
accgccggcaacgccagccagttcagcgacggcgcgggcgcctgcgcgatcgtcagcgag
gactacgcccagaggaagggcctcaagccgctgggccgtttcctcggcttcgccgtggcc
ggctgcgagcccgacgagatgggcatcggcccggtcttcgccgtgcccaaggtgctcaag
cgcctgggcctgaaggtgtcggacatcgacttgtgggaactcaacgaggccttcgccgtg
caggtgctgtactgcgcggacaagctcggcatcccgatggacaggttgaacgtcaacggc
ggcgcgatcgccatcggccatccgtacggcgtgtcgggccagcgcctgaccggccatgcg
ctgatcgaaggcaagcgccgcggcgccaagcgcgtctgcgtgaccatgtgcatcggcggt
ggcatgggcgccgcgggcgtgttcgaggtcctgtga

DBGET integrated database retrieval system