KEGG   Mitsuaria sp. 7: ABE85_17890Help
Entry
ABE85_17890       CDS       T04402                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
miu  Mitsuaria sp. 7
Pathway
miu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:miu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ABE85_17890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:miu02000]
    ABE85_17890
Enzymes [BR:miu01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     ABE85_17890
Transporters [BR:miu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    ABE85_17890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_25 Zeta_toxin SbcCD_C AAA_16 AAA_29 AAA_13 AAA_30 AAA_33 AAA_23 AAA_24 DLIC
Motif
Other DBs
NCBI-ProteinID: ANH68976
UniProt: A0A1A9HLU1
Position
complement(4074772..4076427)
Genome map
AA seq 551 aa AA seqDB search
MTVVLEARGVAKAFRGVPALVDAALTLRAGEVQVLMGQNGAGKSTLIKILAGVQDRDAGT
IALDGVPFAARSPLEAQRAGIAVVHQEVQLCPNLSVAENVLAGRFPRRWGGVAIDWPKVR
EEADAALARLGIQADVRQPLGDFPVAVQQMIAIARALHQQARVLILDEPTSSLDEAETAR
LLQMVRQLREEGVAVLLVTHFLDQAYAVADRFTVFRNGEFVGERGAVELSRMKLVHLMLG
TEHEDKASGGPAQSIASHAPHSFAEPPDALSSDTHAHLGRGAVRASAHWGGSLSRTAGEG
GGEGQRPSILSTLGLGRRGAVEGVDLHVAAGEVLGLAGLLGAGRTETARLLFGADRADTG
EIRIDGSAARLRSPRDAVRAGLAFCPEERKVDGIVAELSVRENIVLALQARRGILRTLSG
GAQRELAERFIRQLGIKTADAETPIGLLSGGNQQKAILARWLATEPRLLILDEPTRGIDI
AAKQDLMDQVLSLCRQGMALIFISSELSEVLRASDRITVLRERRQVAELDADGLDEERLL
HVMAGATEAHA
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgtgctggaggcacgcggggtggcgaaggccttccgcggggtgcccgcattg
gtggacgcggcgctgacgctgcgcgccggcgaagtgcaggtgctgatggggcagaacggc
gcggggaagtccacgctgatcaagatcctcgccggggtgcaggatcgcgacgcggggacg
atcgcgctcgatggggtgcctttcgcggcgcggtctccgctggaggcgcaacgcgccggc
atcgcggtcgtccatcaggaagtgcagctctgcccgaatctctcggtggcggagaacgtg
ctggccggacgcttcccgcgccgctggggcggggtggcgatcgactggccgaaggtgcgc
gaggaagccgatgcggcgctggcgcggctcggcatccaggccgacgtgcggcagcctttg
ggcgactttcccgtcgccgtccagcagatgatcgccatcgcccgcgcgctgcatcagcag
gcgagggtgctgatcctcgatgaaccgacgtcgtcgctcgatgaagcggagacggcacga
ctgctgcagatggtccgtcagctgcgcgaagagggcgtcgcggtgctgctggtcacgcac
ttcctcgatcaggcctacgcagtcgccgatcgcttcacggtgttccgcaatggcgagttc
gtcggcgagcgtggtgccgtggaactgtcgcggatgaaactggtgcacctcatgctcggg
accgagcacgaggacaaggcatccggtggccccgctcagtcaatcgcgtcgcatgctccg
cattccttcgcggagccaccggacgccttgtcctccgacacgcatgcgcacttaggaaga
ggcgcggtgcgggcgtcggcgcactggggtggctccctctcccgcaccgcgggagagggt
gggggtgagggccagcggccgtcgatcctctccaccctcgggctcgggcgccgtggcgcg
gtcgagggcgtcgaccttcacgtcgccgccggcgaagtgctgggtctggcgggcctgctc
ggcgccggccggaccgagaccgcgcgcctgctcttcggcgccgaccgcgccgacaccggc
gagatccgcatcgacggcagcgccgcgcgactgcgcagcccgcgcgacgccgttcgcgcc
ggcctggccttctgccccgaggagcgcaaggtcgacggcatcgtcgccgaactcagcgtg
cgcgagaacatcgtgctcgcactgcaggcgcggcgcggcatcctgcgcacgctctccggc
ggcgcgcaacgcgagctcgccgagcgcttcatccggcagctcggcatcaagaccgccgac
gcggaaacgcccatcggccttctctccggcggcaatcagcagaaggccatcctcgcgcgc
tggctcgcgaccgagcctcgcttgctgatcctcgacgaacccacccgcggcatcgacatc
gccgcgaagcaggacctgatggaccaggtgctgtcgctgtgccggcaaggcatggcattg
atcttcatctcgtcggagctgtccgaagtcctgcgcgcgagcgaccgcatcaccgtgctg
cgcgagcgtcgccaggtggcggagctcgacgcagacggactcgacgaagaacgcctgctg
cacgtgatggccggcgccacggaggcgcacgcatga

DBGET integrated database retrieval system