KEGG   Mitsuaria sp. 7: ABE85_19520
Entry
ABE85_19520       CDS       T04402                                 

Definition
(GenBank) hypothetical protein
  KO
K23274  fructose 5-dehydrogenase small subunit [EC:1.1.99.11]
Organism
miu  Mitsuaria sp. 7
Brite
KEGG Orthology (KO) [BR:miu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ABE85_19520
Enzymes [BR:miu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.99  With unknown physiological acceptors
    1.1.99.11  fructose 5-dehydrogenase
     ABE85_19520
SSDB
Motif
Pfam: FAD-SLDH
Other DBs
NCBI-ProteinID: ANH69214
UniProt: A0A1A9HMS7
Position
complement(4459186..4459818)
AA seq 210 aa
MTHEHDPSQALSRALSRRSLLEMASLAGTALALGGAGLLAAREGLAAAATSAVGAASAAG
AAPAAAALPVADFLRLSVFLTGGQALDATLAGRYQVALAKRDPQFGDSARALLALIRSTQ
AGTIEQLLETPDLQDTLRAATTRIVSAWYLGIVGQDADAELISYAEALMYRPTKDVLVVP
TYGAGPDSWGDQPGVTPPVTLAATNERKTA
NT seq 633 nt   +upstreamnt  +downstreamnt
atgacccatgaacacgatccctcgcaggcgctgagccgcgcgctctcgcggcgcagcctg
ctggaaatggcctcgctggccggcaccgcgctggccctgggcggcgccggcctgctggcc
gcgcgggaaggcctcgcggcggcggccaccagtgccgtcggcgccgctagcgctgcagga
gcggcacctgccgcggccgcgctgccggtcgccgatttcctgcgcctctcggtcttcctg
accggcggacaggcgctggacgcgacgctcgccggtcgctaccaggtggcgctggccaag
cgcgatccgcagttcggcgacagcgcccgcgcgctgttggcgctgatccgcagcacgcag
gccgggaccatcgagcaactcctcgaaacgcccgatctccaggacacgctgcgcgcggcg
accacgcgcatcgtctcggcctggtacctgggcatcgtcggccaggacgccgacgccgag
ctgatcagctatgccgaggcgctgatgtaccgcccgaccaaggatgtcctggtggtgccg
acctacggcgccggtcccgactcctggggcgaccagccgggcgtgaccccgccggtgacc
ctggccgcaaccaacgaacgcaagaccgcatga

DBGET integrated database retrieval system