KEGG   Mitsuaria sp. 7: ABE85_20130Help
Entry
ABE85_20130       CDS       T04402                                 

Definition
(GenBank) segregation protein A
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
miu  Mitsuaria sp. 7
Pathway
miu00450  Selenocompound metabolism
miu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:miu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ABE85_20130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:miu03016]
    ABE85_20130
Enzymes [BR:miu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     ABE85_20130
Transfer RNA biogenesis [BR:miu03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    ABE85_20130
 Prokaryotic type
    ABE85_20130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ANH69300
UniProt: A0A1A9HQL7
Position
4590972..4592048
Genome map
AA seq 358 aa AA seqDB search
MTPHDASPAPVSEPRLTSLSHGGGCGCKIAPGVLSEILKSTNALPVPKELLVGIETSDDA
AVYRLNDEQALVATTDFFMPIVDDPHDFGRIAATNAISDVYAMGGRPIMALALVGMPIAV
LSAATIGRILEGGASVCRQAGIPIAGGHTIDSVEPIYGLVALGLVHPSRVKRNADAKVGD
VLVLGKALGVGVMSAALKKGRLDDASYQRMLETTTLLNTPGPELAALDGVHALTDVTGFG
LAGHALEIARGSRCGIELDWAAVPLLEGVRSLAADGLITGASGRNWSAYGTEIALSASLP
TETQALLSDPQTSGGLLVSCTPAAVGHVLDVFARHGFGAASVIGRLVASDDGARLKVS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgacgccccacgacgcatcccccgccccggtctccgagccgcgattgacttcgctgtcc
cacggcggcgggtgcggatgcaagatcgcgccaggcgtgctctcggagattctcaagagc
acgaatgccctgccggtgcccaaggagttgctggtcggcatcgaaacctcggacgacgcg
gcggtctatcgactcaacgatgagcaggccctggtggcgacgaccgatttcttcatgccg
atcgtcgacgacccgcacgactttggccgcattgccgcgaccaatgcgatcagcgacgtc
tacgcaatgggagggcggcccatcatggcgctggcactcgtcggcatgccgatcgcggtg
ctgagcgcagcgacgatcggacgcatccttgaaggcggcgcttccgtctgccgtcaggcg
gggatccccatcgccggtggacacacgatcgactccgtcgagccgatctatggactggtc
gcgctgggactcgtccatccttcgcgcgtgaaacgcaacgcggacgccaaggtcggcgat
gtgctcgtgctgggcaaagcgcttggcgtgggcgtgatgtcggccgcgttgaagaagggc
agactcgacgacgcgtcctatcaacggatgctggagacgaccaccctcttgaacacgccc
gggcccgagctggcggcactcgacggcgtgcatgcgctgaccgacgtgaccggcttcggc
ctggccgggcatgcgctcgagatcgcacgtggatcgcgctgcgggatcgaactcgattgg
gcggcggtgcccttgctcgagggcgtccgatcgctggccgccgacggcctgatcaccggg
gcgtcgggacgcaactggtccgcctatggcaccgagatcgcactctccgcctcgttgccg
acggagacgcaagcactgctcagcgatccgcagaccagtggtggcctgctcgtctcgtgc
accccagcggccgttggtcatgtgctggacgtctttgcgcgacatggcttcggcgccgcc
tccgtcatcgggcgcctggtcgcatctgacgacggcgcacgactgaaagtcagctga

DBGET integrated database retrieval system