KEGG   Microvirga sp. 17 mud 1-3: C4E04_01995Help
Entry
C4E04_01995       CDS       T05470                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
miv  Microvirga sp. 17 mud 1-3
Pathway
miv02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:miv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    C4E04_01995
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:miv02000]
    C4E04_01995
Enzymes [BR:miv01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     C4E04_01995
Transporters [BR:miv02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    C4E04_01995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 RsgA_GTPase AAA_23 Zeta_toxin AAA_30 AAA_16 MMR_HSR1 DUF2813
Motif
Other DBs
NCBI-ProteinID: AWM85637
UniProt: A0A2Z3I6N7
Position
complement(434154..435662)
Genome map
AA seq 502 aa AA seqDB search
MPELTEQPKLLEIRGLTKGFPGVQALDHVDFALDAGEIHGLLGENGAGKSTLIKVLTGVF
RRDAGTIRLDGQEFEARDPADALSLGIGTVYQEVNLLPNLSVADNLYIGRQPHRFGLVRT
GEMRRLSEELLASYGLDINVANPLSTYSVAVQQIVAIARAVDLSAKVLILDEPTASLDAH
EVEILFKILRDLKSRGIGIVFVTHFLDQVYAICDRITVLRNGRLVGSRPIADLPRIELVS
MMLGRELAAEALHRNQRSAVMGEPLVAFKDYGKRRLVEPFDLAVRPGEVVGLAGLLGSGR
TETARLMFGIERADSGQAFVDGKPVRIATPREAARLRFGFTPEDRKTEGIVAELSVRENI
ILALQAQRGWLRLIPRRRQEDIAERFIKLLDIRTPDAEKPIGLLSGGNQQKALLARWLAT
EPRFLILDEPTRGIDVGAHAEIIRLIEQLCEDGLALLVISSELEEIASYSDRVVVLRDRR
HVRELSGDEVNADTIMTTIASF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattgacagagcagcccaagctccttgagatccggggcctcacgaagggtttt
ccgggcgtgcaggcgctggaccacgtggatttcgcgctggatgcgggcgagatccacgga
ctgctcggcgagaacggcgccggcaagtcgacgctgatcaaagtgttgaccggtgtcttc
agacgcgatgccggaaccattcgcctcgacgggcaggaattcgaagcgcgggatcctgcg
gatgcgctctcactgggtatcggaaccgtctatcaggaagtcaatcttctgccgaacctg
tcggtcgcggacaatctctacatcggccgccagccgcaccgtttcggcctcgtccgcaca
ggcgagatgcggcgcctctcggaggagttgctcgcaagctacgggctcgacatcaatgtt
gccaatcctctgagcacctattcggtggccgtccagcagatcgttgccatcgcccgtgcg
gtcgatctctcggccaaggtgctgatccttgacgagccgacggcgagcctcgatgcgcat
gaggtcgaaatccttttcaagatcctgagggatctcaagagccgtggcatcggcatcgtg
ttcgtcacgcactttctcgaccaggtctatgcgatctgcgaccggatcacggtgttgcgc
aatggacgcctcgtgggctcccgcccgatcgccgacctgccacggatcgagcttgtctcc
atgatgctcgggcgcgaactcgcggcggaggcccttcatcgtaatcagcggagcgccgtc
atgggtgagccgctggtcgcattcaaggattacggcaagcgccggctcgtcgagccgttc
gatctggcggtgcgtcccggcgaggtggtgggtcttgcgggcctcctcggctccggtcgt
acggaaacggcgagattgatgttcggcatcgagcgtgcggacagtggccaagccttcgtg
gacggcaagcccgtgcgcatcgccacgccccgcgaggcagcccggctgcggttcgggttc
acgcccgaagaccgcaagacggaaggaatcgtggctgagctgtcagttcgcgaaaacatc
atcctggcgctccaggcacagcgcggttggctgcgtctgatcccaagacgcaggcaggag
gacattgccgagcgcttcatcaagcttctcgatatccgcacccccgatgcggaaaagcct
attgggctgctgtcgggaggcaaccagcagaaggcactccttgcccgctggctcgccacc
gaaccacggttcctgatccttgacgaacccacacgcgggatcgacgtgggtgcacatgcg
gagatcatccgcctgatcgagcagctttgcgaggacggacttgctcttctcgtcatctcc
tctgagctcgaagagatcgcgtcctacagcgatcgcgtggtcgtgctccgcgaccgtcgg
catgtgcgggagctctcgggcgacgaggtgaatgccgataccatcatgacaaccatcgcg
agcttttga

DBGET integrated database retrieval system