KEGG   Microvirga sp. 17 mud 1-3: C4E04_02090Help
Entry
C4E04_02090       CDS       T05470                                 

Definition
(GenBank) ADP-forming succinate--CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
miv  Microvirga sp. 17 mud 1-3
Pathway
miv00020  Citrate cycle (TCA cycle)
miv00640  Propanoate metabolism
miv00660  C5-Branched dibasic acid metabolism
miv01100  Metabolic pathways
miv01110  Biosynthesis of secondary metabolites
miv01120  Microbial metabolism in diverse environments
miv01130  Biosynthesis of antibiotics
miv01200  Carbon metabolism
Module
miv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
miv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:miv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C4E04_02090
   00640 Propanoate metabolism
    C4E04_02090
   00660 C5-Branched dibasic acid metabolism
    C4E04_02090
Enzymes [BR:miv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     C4E04_02090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AWM85653
UniProt: A0A2Z3I426
Position
451802..453001
Genome map
AA seq 399 aa AA seqDB search
MNIHEYQGKAILKEFGLPVSRGKAIFSPDEAEAAAKELGGPLWVVKSQIHAGGRGKGKFK
EAAAGEKGGVRLAKSVDEVKEFAKQMLGNTLVTVQTGEAGKQVNRLYIEDGSDIETEFYL
SMLVDRATGRVAFVVSTEGGMDIEQVAHDTPEKILTFSVDPATGVQPFHGRKVAKALGLT
GALSKEAGDLVTKLYAAFVSKDMSMLEINPLIVTKDGHLKCLDAKISFDSNALYRHPELM
ELRDLTEEDEKEIEASKYDLAYIALDGTIGCMVNGAGLAMATLDIIKLYGEEPANFLDVG
GGASEEKVTAAFKIITADPNVQGILVNIFGGIMKCDVIARGVIAAVKTVGLQVPLVVRLE
GTNVEEGKQIIRESGLNVIPADDLDDAAQKIVNAVRGGK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgaataccagggcaaggccatcctcaaggagttcggcctgcccgtgtcc
cggggcaaggccatcttctccccggacgaggccgaggctgctgccaaagagctcggtggc
ccgctctgggtcgtgaagtcccagatccatgcgggcggccgcggcaagggcaagttcaag
gaagccgctgccggcgagaagggcggcgtgcgcctcgccaagtcggtcgacgaggtgaag
gaattcgccaagcagatgctcggcaacaccctcgtgaccgtgcagacgggcgaggccggc
aagcaggtcaaccgcctctatatcgaggacggctcggacatcgagaccgagttctacctc
tccatgctggtcgaccgcgccacgggccgcgtcgctttcgtcgtctcgacggaaggcggc
atggatatcgagcaggtggcgcacgacacccctgagaagatcctgaccttctcggtcgat
ccggcaaccggcgttcagcccttccacggccgcaaggtcgccaaggccctcggcctcacg
ggcgccctctccaaggaagcgggcgacctcgtgacgaagctctacgcggccttcgtttcg
aaggacatgtcgatgctcgagatcaacccgctgatcgtcaccaaggacggtcacctgaag
tgcctcgatgcgaagatctccttcgactcgaacgccctctatcggcaccccgagctcatg
gagctccgggacctgacggaggaggacgagaaggaaatcgaggcgtccaagtacgacctc
gcctatatcgccctcgacggcaccatcggctgcatggtcaacggcgccggcctcgccatg
gcgacgctggacatcatcaagctctacggcgaggagccggcgaacttcctcgatgtcggc
ggcggcgcgtccgaggagaaggtcacggcggccttcaagatcatcacggccgatccgaac
gtgcagggcatcctggtcaacatcttcggcggcatcatgaagtgcgacgtcatcgcccgc
ggcgtgatcgcggccgtgaagaccgtcggcctgcaggttccgctggtggtccgcctcgaa
ggcaccaatgtcgaggaaggcaagcagatcatccgcgagtccggcctcaacgtcatcccg
gccgacgacctggacgatgccgcccagaagatcgtgaacgccgtccgcggcgggaagtaa

DBGET integrated database retrieval system