KEGG   Mycobacteroides immunogenum: BAB75_02525Help
Entry
BAB75_02525       CDS       T04755                                 

Definition
(GenBank) exodeoxyribonuclease V subunit gamma
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
miz  Mycobacteroides immunogenum
Pathway
miz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:miz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BAB75_02525
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:miz03400]
    BAB75_02525
Enzymes [BR:miz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BAB75_02525
DNA repair and recombination proteins [BR:miz03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BAB75_02525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: ANO02426
UniProt: A0A0N0KM45
Position
complement(500753..503986)
Genome map
AA seq 1077 aa AA seqDB search
MALHLRRAERTDMLADGLARLLSEPAADPFAQELVLVPAKGIERWLSQRLSCHLGVCAGV
RFRSPRSLIAEITGTAQDDPWSPEALVWPLLSVIDEHLDEPWARPLATHLGQFEAGEERE
LRQGRRYAVARRLAGLFTSYARQRPELLISWLDGDAVEPDLAWQPPLWRALVSRVDAVPP
HVRHGQVLARLREAPSDLPARISLFGHTRLPVTDIELLDALSTHHDLYLWLPHPSDTLWH
TLCAEHGAVPRREDTGHRAVRHPLLATLGRDVRELQRALPPSVSDEYLSGATFSDTLLGW
LQSDLAADQIRPEGRVLAPGDRSVQVHSCHGPARQIDVLREVLLGLLADDPTLEPRDILV
MCPDIETYAPLISARFGLGESVPGAHPAHQLRVRLADRALVQTNPLLTVAAQVLALASGR
ATASEVLNLAETAPVRTRFGFSDDDLDAITAWVREANIRWGFDPGHRTPYGVDFLHNTWR
FGIDRVLAGVAMSEDSHAWLGATLPLDDVSSNRVELAGRFAEFIARLHTTVTSLSGARPL
DQWLTALSTGIEALAEDAEDWPRAQMLREFAEILAQADPVSLRLSDIRALLDRHLAGRPT
RANFRTGTLTVCTMVPMRSVPHRVVCLVGLDDGVFPRLGAVDGDDALARDPRTGERDIRS
EDRQLLLDAIGAATETLVLTYTGANEYSGQARPPAVPLAELLDALDVTTPQPVRSRVHVT
HPLQPFDIRNVTPGGVIPAVPFTFDTTALTAARAAAGARAQRPPFISGPLPAPAVADVAL
ADLATFFNHPIKGFFRALDYTLPWDVDGVSDDMPVEIDALEEWTVGDRMLADMLRGMSAA
DAQQAEWRRGTLPPGQLGWRRVSELRDRCAALAEVTRGYRTADTRAFDVDINLGDGRRLT
GTVSPVFDERLVSVTYSRLDAKHLLQSWIPLVALTAHDPRPDWSAVCIGRARRGPQPLAR
TLGRPGNAVDVLRDLVAVYDAGRREPLPLPLKTSYAWAQARLDRDDPELQAGYRWRSGNF
PGEDADPAVERAFGKGVWLRHLMQPLRSGEETEGETNRLGAYSARLWLPLLRAERGS
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atggcacttcacctgcgccgggccgagcggaccgacatgctcgccgacgggctcgcccgg
ctgctgtccgaacctgccgcggacccctttgcgcaggagttggtgctggtgccggccaag
ggcatcgaacggtggctgagccagcggttatcctgtcacctcggggtgtgcgcgggtgtg
cgattccgcagcccgcgctcgctgatcgccgagatcaccggcacggcgcaggacgatcca
tggtcgcccgaggcgctggtctggccgctgctctcggtgatcgacgagcacctggatgag
ccctgggcgaggccactggccactcatctcgggcagtttgaggccggtgaggaacgtgag
ctgcgccagggccgccgctacgcggtggcgcgccggctcgccgggctgttcacgtcctat
gcccgccagcgcccggagctgttgatctcctggctggacggcgacgccgtcgaaccggac
ctggcctggcagccgccgctgtggcgggcactggtttcgcgtgtcgacgccgtccctccg
catgtccggcacggccaggtactggcgcgcctgcgggaggcaccgtcggacctgccggca
cgaatctccctgttcgggcacacacgactcccggtgaccgatatcgaattgctcgacgca
ctctcgacgcatcacgatctgtacctgtggctgccacatcccagtgacacgctctggcac
acattgtgcgcggagcacggcgcagtaccccggcgcgaagacaccgggcaccgcgcggta
cgccatcccctgctggccacgctgggacgggacgtgcgcgagctgcagcgcgccctgcca
ccgtcagtgtctgacgaatatctgagtggcgcaacattttccgacaccctgctgggctgg
ctgcaatccgacctagcggccgaccagatccgtccggaggggcgggtgctggctcccggc
gaccgatccgtgcaagtgcattcctgccacggtcccgcgcgtcagatcgatgtactgcgc
gaggtgctcctgggcctgctggccgacgatcccacgctggaaccccgcgacattctcgtc
atgtgcccggacatcgaaacgtatgcgccgctgatatcggcccgcttcggtctcggtgaa
tcggtgcccggcgcccatccggcccatcaactccgggtccggctcgccgatcgagctctg
gtgcaaaccaatccgctgttgacggtcgccgcgcaggtactggcgctggccagcggacgg
gccaccgcgagcgaggtcttgaacctcgcggaaacggcgccggtgcgcacgcgatttggt
ttctccgacgacgacctggacgcgatcaccgcgtgggtgcgggaggcgaacatccgctgg
ggattcgaccccgggcatcgcacgccctacggcgtcgattttctccacaacacctggcgt
ttcggtatcgaccgagtgctggccggggtggcgatgtccgaggactcgcacgcgtggctg
ggcgccacgctgcccctcgatgatgtgagcagcaaccgggtcgagctggccggccgcttc
gccgaattcattgcgcggctccacacgacggtgacgtcactgagcggtgcccggcccctc
gatcagtggctcacggcgttgtccaccggcatcgaggccctcgccgaggacgcggaggac
tggccccgcgcccagatgctgcgcgagttcgccgagatccttgcgcaggctgatccggtc
tcgttgcggctcagcgatattcgtgcgcttctggatcgccacctggcgggccgccccacc
cgcgccaacttccgcaccgggacactgacggtctgcaccatggtgcccatgcgttcggtt
ccgcaccgggtggtctgcctggtcgggctcgatgacggcgtgttcccccggctcggcgcc
gtcgacggggatgacgcactggcccgtgacccgaggaccggtgagcgcgatatccgttcc
gaagaccggcaattgctgctcgacgcgatcggtgctgccaccgaaaccctggtgctcacc
tacaccggcgccaatgagtactcggggcaggcccgtcccccggcggtgccgctggccgaa
ctgctcgacgcgttggacgtcaccaccccacaaccggttcggtcgcgggtgcacgtgaca
caccccttgcagccgttcgatattcgcaatgtgacaccgggcggtgtgattcccgcagtc
cccttcaccttcgacaccaccgcgctgaccgcggcccgcgcggccgcgggtgcgcgggcg
cagcggcccccgttcatctccggtccgctacccgcaccggccgtggccgacgtggccttg
gcggacctcgccacgtttttcaaccaccccatcaaggggttcttccgggccctggactac
accctgccgtgggatgtggacggggtctccgacgatatgccggtcgagatcgacgccctc
gaagagtggacggtgggtgaccgcatgctggccgacatgctgcgcggcatgtcggccgcc
gacgcacagcaggccgaatggcgccgcggcactttacctcccggccaactcggctggcgg
cgcgtctccgagctgcgggaccgttgtgcggcgctggccgaagtgaccagggggtaccgc
accgccgatacccgcgccttcgacgtcgatatcaatctcggtgatgggcgccgccttacc
ggcacggtatccccggtgttcgatgagcggctggtatcggtcacctattcgcgactcgat
gccaaacatctgctgcaatcgtggattcccctggtggcgttgaccgcccatgacccgcgg
cccgattggtcggcggtgtgcattggccgcgccaggcgcggtccacaaccgctggcgcgc
accctcgggcgacccggcaacgcggtggacgtgctgcgtgacttggtggctgtgtatgac
gcggggcgccgcgagccgttgcccttgccgctaaagacctcctatgcgtgggcgcaggcc
cgcctcgatcgcgacgatcccgagttgcaggccggataccgttggcgttccggaaacttc
ccgggcgaggacgccgatcctgcggtcgagcgcgccttcggaaagggtgtctggttgcgg
catttgatgcagccgctgcggtccggcgaagagaccgagggcgaaacgaaccgactcgga
gcgtattccgcgcggttatggctgccgctgctgcgggcggagcgtggctcatga

DBGET integrated database retrieval system