KEGG   Mycobacteroides immunogenum: BAB75_03615Help
Entry
BAB75_03615       CDS       T04755                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
miz  Mycobacteroides immunogenum
Pathway
miz00071  Fatty acid degradation
miz00072  Synthesis and degradation of ketone bodies
miz00280  Valine, leucine and isoleucine degradation
miz00310  Lysine degradation
miz00362  Benzoate degradation
miz00380  Tryptophan metabolism
miz00620  Pyruvate metabolism
miz00630  Glyoxylate and dicarboxylate metabolism
miz00640  Propanoate metabolism
miz00650  Butanoate metabolism
miz00900  Terpenoid backbone biosynthesis
miz01100  Metabolic pathways
miz01110  Biosynthesis of secondary metabolites
miz01120  Microbial metabolism in diverse environments
miz01130  Biosynthesis of antibiotics
miz01200  Carbon metabolism
miz01212  Fatty acid metabolism
miz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:miz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAB75_03615
   00630 Glyoxylate and dicarboxylate metabolism
    BAB75_03615
   00640 Propanoate metabolism
    BAB75_03615
   00650 Butanoate metabolism
    BAB75_03615
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAB75_03615
   00072 Synthesis and degradation of ketone bodies
    BAB75_03615
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAB75_03615
   00310 Lysine degradation
    BAB75_03615
   00380 Tryptophan metabolism
    BAB75_03615
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAB75_03615
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAB75_03615
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BAB75_03615
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:miz04147]
    BAB75_03615
Enzymes [BR:miz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAB75_03615
Exosome [BR:miz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAB75_03615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ANO02606
UniProt: A0A0N0KMC3
Position
712394..713542
Genome map
AA seq 382 aa AA seqDB search
MPEAYIIDAVRTAVGKRNGSLSKVHPLDLGAATFKGLFDRVDVDPDAIDDVYMGVLDAIG
GQAGNAGRLAWLAGGYPEEVPGATVDRQCGSSQQAISFAAQAVMSGTADLIVAGGFQNMS
QIPISAAMLVGKEYGFTSPTAESEGWLHRYGDQEISQFRGAEMIAEKWDISREEMELFAL
SSHEKAFAAIRNGHFDNEIIPVGDFRVDEGPRESTLEKLASLKPLVEGGRLTAALASQIS
DGGSATLVASEGAVKAHGLTPRARVHHISARGDDPVFMLTGPIPATRYALEKTGLTMDDI
DVVEINEAFAPVVLAWAKELDVDLKKVNPNGGAMALGHPLGATGAKLFATMLNELERTGG
RYGLQTMCEGGGTANVTIIERL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggcgtacatcatcgatgctgtgcgtaccgctgtcggtaagcgcaacggctcg
ctctccaaggtgcacccgcttgatctcggtgccgccacgttcaaggggttgttcgatcgc
gtcgacgtcgaccccgacgccatcgacgacgtgtacatgggcgtgctggacgccatcggc
ggacaggccggcaacgccggacgactggcctggctggccggtggatacccggaagaagta
ccgggcgccactgtcgatcgtcagtgtggatcgagccagcaggccatttcctttgccgcg
caggctgttatgtccggaaccgccgacctgatcgttgccggtggtttccagaacatgagc
cagatcccgatctcggccgcgatgctcgtcggcaaggagtacggattcacctcgcccaca
gcagaatcggaggggtggctgcaccgctacggcgatcaggagatctcccagttccgcggc
gccgagatgatcgccgagaagtgggacatcagccgcgaggagatggagcttttcgcgctc
tccagccacgagaaggcattcgccgcgatccgcaacgggcacttcgacaacgagatcatc
ccggttggcgacttccgcgtcgacgagggaccgcgcgaatccactctggagaagttggcg
agcttgaagcctctggtcgagggcggccgcctcaccgcggcgctcgccagccagatctcc
gacggcggtagcgccacattggtggcctccgagggtgcggtgaaggcacacggcctgacg
ccgcgtgcgcgtgtccaccacatcagcgcccgcggtgacgacccggtgttcatgctgacc
ggaccgatcccggccacccggtacgcgctggagaagaccggtctgaccatggacgatatc
gacgttgtcgagatcaacgaggccttcgcccccgtcgtgctggcctgggccaaggagttg
gacgtcgacctgaagaaggtcaacccgaatggcggtgcgatggccttggggcacccgctg
ggtgccaccggcgccaagctgttcgccaccatgctcaacgagttggagcgcaccggcggg
cgctacggcctgcagacgatgtgtgagggtggcggcaccgccaacgtcaccatcatcgaa
cgtctctga

DBGET integrated database retrieval system