KEGG   Mycobacteroides immunogenum: BAB75_05990Help
Entry
BAB75_05990       CDS       T04755                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
miz  Mycobacteroides immunogenum
Pathway
miz00450  Selenocompound metabolism
miz00970  Aminoacyl-tRNA biosynthesis
miz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:miz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BAB75_05990
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BAB75_05990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:miz01007]
    BAB75_05990
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:miz03016]
    BAB75_05990
Enzymes [BR:miz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BAB75_05990
Amino acid related enzymes [BR:miz01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BAB75_05990
Transfer RNA biogenesis [BR:miz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BAB75_05990
 Prokaryotic type
   Other AARSs
    BAB75_05990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ANO03006
UniProt: A0A0N0KP47
Position
complement(1205158..1206729)
Genome map
AA seq 523 aa AA seqDB search
MPESLDPFYITTAIAYPNGEPHIGHAYEYVATDSVARFKRLDGFDVRYLTGTDEHGLKVA
QTAAAAGIPTAELARRNSDVFEALQRTLNISFDRFIRTTDPDHYEASKAIWRRMADNGDI
YLDTYSGWYSVRDEAYYTDAETTVAPDGTRTATATGTPVDWTEEHSYFFRLSAYQDKLLA
HYAAHPEFIGPDVRRNEVVSFVSGGLRDLSISRTTFDWGVPVPDNPEHVMYVWVDALTNY
LTGVGYPDTDSELFGRYWPAHVHMIGKDIIRFHTVYWPAFLMSAGIELPKRVFAHGFLTN
KGEKMSKSIGNVVDPINLVNTFGLDQVRYFLLREVPFGQDGSYTEEGLINRINADLANEL
GNLAQRSLSMVAKNLGGVVPQPGEFAAEDLELLDAADKLLEQAREHFEVPAMHLALEAIW
QVLGASNRYFSAQEPWVLAKSLQADGAAADQQRFGTVLYTTLEVVRIVALLVQPVMPESA
AKLLDLLGQSEDQRDFAAIGTRLKPGVSLPAPTGVFPKYQVPK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaatcattggatccgttctacatcaccaccgccatcgcgtacccgaacggcgaa
ccgcacatcggacacgcatatgagtacgtcgcgaccgattccgtcgcccggttcaaacga
ctggacggcttcgacgtgcgctatctcacgggcaccgacgagcacggcctgaaggtggcg
cagacggccgccgcggccggaatcccgacggcagagctcgcccgacgcaactccgatgtg
ttcgaggcactgcagcgcacgctcaacatctcgttcgaccgattcatccgcaccaccgat
ccggatcattacgaggcctcgaaggcgatctggcgcaggatggccgacaacggcgacatc
tacctggacacctactccggctggtactcggtgcgcgacgaggcgtattacaccgacgcg
gagaccacggtcgcccccgatggcacccgcaccgccaccgcgacgggcacgccggtcgac
tggaccgaggagcattcctacttcttcaggctctcggcgtaccaggacaagctgctggcg
cactacgcggcacatcccgaattcatcggtcccgatgtgcggcgcaacgaggtggtcagc
ttcgtctccggcgggctgcgcgacctatccatctcgcgcaccaccttcgactggggtgtg
ccggtacccgataaccccgaacacgtcatgtacgtgtgggtggacgcgctcaccaactac
ctgaccggagtcggctaccccgataccgattcggagctgttcgggcgctactggccggcc
cacgtccacatgatcggcaaggacatcatccggttccacaccgtgtactggcccgccttc
ctgatgtcggccggaattgaactgcccaagcgggttttcgcgcacggcttcctgaccaac
aagggcgagaagatgagcaagtcgatcggcaatgtcgtcgaccccatcaacctggtcaat
acctttggtctggaccaggtgcgctacttcctgttgcgcgaggtgccgttcggccaagac
ggcagctacaccgaagaaggactaatcaaccggatcaacgccgacctggccaacgaattg
ggcaacctggcgcagcgctcactgtcgatggtggccaagaatctcggcggagtcgtgccg
caaccgggcgaattcgccgcggaagacctggagctgctggacgctgccgacaagctcttg
gagcaggcccgcgagcatttcgaggtgcccgccatgcatctggcgctggaggcgatctgg
caggtgctgggcgccagtaaccggtatttctccgcgcaggagccgtgggtgttggccaag
agcctccaggcggacggcgccgcagccgatcagcagcgattcggcaccgtgctgtacacc
acgcttgaggtggtccggattgtcgcgctgttggtgcagccggtgatgcccgagtcggcc
gccaagctcctcgatctgctgggccagtccgaagaccagcgggacttcgccgccatcggg
acacggctgaagcccggcgtcagcctgcccgcaccgacgggcgtgttcccgaagtatcag
gtgcccaagtag

DBGET integrated database retrieval system