KEGG   Mycobacteroides immunogenum: BAB75_10610Help
Entry
BAB75_10610       CDS       T04755                                 

Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
miz  Mycobacteroides immunogenum
Pathway
miz00260  Glycine, serine and threonine metabolism
miz00630  Glyoxylate and dicarboxylate metabolism
miz00670  One carbon pool by folate
miz01100  Metabolic pathways
miz01110  Biosynthesis of secondary metabolites
miz01130  Biosynthesis of antibiotics
miz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:miz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BAB75_10610
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAB75_10610
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BAB75_10610
Enzymes [BR:miz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     BAB75_10610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: ANO03769
UniProt: A0A0N1CDX9
Position
2127979..2129082
Genome map
AA seq 367 aa AA seqDB search
MTDLLLGPLHDRHAAQGATFAEFGGWNMPVSYAGTVGEHTATREAVGLFDVSHLGKALVR
GPGAAAFVNACFTNDLNKVGPGKAQYTLCCQESGDVAGVIDDLIAYYVSDDEIFLVPNAA
NTAAVVAALQDKAPEGITITNQHRDYAVLAVQGPKSADVLKRLGLPTDMEYMAYADATLD
GVPVRVCRTGYTGEHGYELLPSWNDAGAVFDALLPAIVEAGGQLAGLGARDTLRTEMGYP
LHGHELSADISPVQARAGWAVGWKKDEFWGREALVREKSAGPVRTLRGLRATGRGVLRPD
LTVLSGGQPVGVTTSGTFSPTLKTGIALALLDTAAQIPDGATVVVDVRGREIECEVVKPP
FVDVNVG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccttttgctcggaccactccatgatcggcacgccgcacagggcgccaccttc
gctgagttcggcggctggaacatgccggtgtcgtacgcaggcaccgtgggggagcacacc
gccacgcgcgaggcggtcggtctgttcgacgtgagtcatctgggcaaggcgctggtacgc
ggaccgggcgcggcggccttcgtcaatgcgtgtttcaccaacgacctcaacaaggttggg
ccgggcaaggcgcagtacacgttgtgctgccaggaatcgggcgatgtggccggtgtcatt
gatgacctcatcgcctactacgtgtccgacgatgagatcttcctggtgcccaacgccgcc
aacaccgccgccgtggtcgctgccctgcaggacaaggcgcccgaggggatcaccatcacc
aatcagcaccgcgattacgcggtgctggccgtgcaggggcccaaatccgcggatgtgctg
aaacggctgggtctgccaacggatatggaatacatggcctacgccgacgcgacactcgac
ggagtgccggtgcgggtgtgccgtaccggatacacgggcgagcacggctacgagctgctg
ccgtcctggaacgacgccggcgcggtgttcgacgccctgctaccggcgatcgtcgaggcg
ggtgggcagctggccgggctgggcgcacgtgacaccttgcgcaccgagatgggttacccg
ctgcacggccacgagctttccgccgatatcagcccggtccaggcccgcgcgggatgggcc
gtgggctggaagaaggacgagttctgggggcgcgaggcgctcgttcgcgaaaagagcgca
ggacccgttcggacgctgcgcggcctgcgcgcgaccggccggggtgtgctgcgccccgac
ctcacggtgctctccggcggccagccggtcggggtcaccacctcgggaaccttctcgccg
acactcaagaccggaatcgcgctggcgctgctggataccgcggcccagatcccggatggc
gcgaccgtggtcgtcgacgtgcgcgggcgcgagatcgaatgcgaggtcgtcaagccgcca
ttcgtggacgtcaacgtcggataa

DBGET integrated database retrieval system