KEGG   Mycobacteroides immunogenum: BAB75_16620Help
Entry
BAB75_16620       CDS       T04755                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
miz  Mycobacteroides immunogenum
Pathway
miz00670  One carbon pool by folate
miz00790  Folate biosynthesis
miz01100  Metabolic pathways
Module
miz_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:miz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BAB75_16620
   00670 One carbon pool by folate
    BAB75_16620
Enzymes [BR:miz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BAB75_16620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ANO04762
UniProt: A0A0N1CHN3
Position
complement(3390478..3390969)
Genome map
AA seq 163 aa AA seqDB search
MTGTIGLIWAQSRGGVIGADGAIPWRLPEDQARFKRITMGHTVIMGRKTWESLPASVRPL
PGRPNIVLTRDALFEPDGALAVGCTDAALAASDESPWVIGGGEIYRLFLPLAQRCEVTVV
DADVAGDALAPQLGDGWVVEENDWQTSESGLRYQFLSYRRADG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacggggaccatcgggctgatttgggcacaatcgcgcggcggcgtcatcggtgcggat
ggcgcgatcccgtggcgactgcccgaagatcaggcgcgcttcaagcgaatcaccatgggg
cacacggtgatcatgggtcgcaagacctgggaatcgcttcccgccagtgtccggccgttg
ccggggcggcccaacatcgtgctgaccagggatgcgttgttcgagccggacggggcgctg
gccgtcgggtgcacggacgcggccctggcggcatctgacgagtcgccgtgggtgatcggt
gggggcgagatctatcggctgttcctgccgttggcgcagcggtgcgaggtgacagtggtg
gacgccgatgtggcgggtgacgctctggctccgcagctcggtgacggttgggttgtcgag
gaaaatgattggcagacaagtgaatccggcctgcggtatcagtttttgagctatcggagg
gccgacggatga

DBGET integrated database retrieval system