KEGG   Methanocaldococcus jannaschii: MJ_0091
Entry
MJ_0091           CDS       T00003                                 

Name
(GenBank) Na+/Ca+ exchanger protein, putative
  KO
K07301  cation:H+ antiporter
Organism
mja  Methanocaldococcus jannaschii
Brite
KEGG Orthology (KO) [BR:mja00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mja02000]
    MJ_0091
Transporters [BR:mja02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   MJ_0091
SSDB
Motif
Pfam: Na_Ca_ex HEPN_RnaseLS
Other DBs
NCBI-ProteinID: AAB98072
UniProt: Q57556
Structure
PDB: 

Position
85705..86613
AA seq 302 aa
MLILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAY
ASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGI
DGFSWIDGVVLLILFIIYLRWTVKNGSAEIEENNDKNNPSVVFSLVLLIIGLIGVLVGAE
LFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIAD
IGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR
MG
NT seq 909 nt   +upstreamnt  +downstreamnt
atgctaattttaggggttggttattttctattagggcttattctactgtattatgggagc
gattggtttgtcttaggaagtgagaggatagcaaggcattttaatgtgtcaaactttgtc
attggagctacggttatggctattggaacatctctgccagagatattaacatctgcttat
gcttcttatatgcatgctccgggcatatcaataggaaatgccattggttcttgtatctgc
aatataggtttagtccttggcttaagtgcaattataagtccaataatagttgataaaaac
ttacaaaagaatatattagtttatcttctatttgttatatttgctgcagttataggaatt
gatggattttcatggattgatggagttgttttgctaattttatttattatctacttaaga
tggactgtaaagaatggaagtgctgagatagaagaaaataatgataaaaacaacccttca
gtagtgttctccttagttttgttaataattgggttaattggtgttttagttggagctgaa
ttatttgttgatggagcaaagaagatagcgttagctttagatatatctgataaggttatt
ggatttaccttagtggcatttggaacatctctaccagagttaatggtttccttagcagca
gcaaagagaaaccttggaggcatggtcttaggaaatgtcattggaagtaacatagctgat
attggtggcgctttggcagttggaagtttatttatgcatctcccagcggaaaatgtacaa
atggctgtgttggtaattatgagccttttactctatttatttgcaaaatactcaaagatt
ggtagatggcaaggaattttatttttagctctatatataattgcaatagcttctttgagg
atgggataa

DBGET integrated database retrieval system