KEGG   Methanocaldococcus jannaschii: MJ_0262
Entry
MJ_0262           CDS       T00003                                 

Definition
(GenBank) translation initiation factor aIF-2 (infB)
  KO
K03243  translation initiation factor 5B
Organism
mja  Methanocaldococcus jannaschii
Brite
KEGG Orthology (KO) [BR:mja00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mja03012]
    MJ_0262
Translation factors [BR:mja03012]
 Eukaryotic type
  Initiation factors
   eIF-5
    MJ_0262
SSDB
Motif
Pfam: GTP_EFTU_D4 GTP_EFTU Intein_splicing IF-2 LAGLIDADG_3 GTP_EFTU_D2 LAGLIDADG_WhiA Phage_Gp17 HTH_3 MMR_HSR1 Ras ATP_bind_1 PT-HINT Ribosomal_L11
Other DBs
NCBI-ProteinID: AAB98248
UniProt: Q57710
Position
247241..250708
AA seq 1155 aa
MAKKNTKKDNKNQNLRCPIVCVLGHVDHGKCLMPHEKVLTEYGEIKIEDLFKIGKEIVEK
DELKEIRKLNIKVHTLNENGEIKIINAPYVWKLKHKGKMIKVKLKNWHSITTTPEHPFLT
NNGWIKAENIKKGMYVAIPRKIYGNEDFEKFIEFINSKILTNELIVKVNEKDLKNVELPS
TKIYKKQKNVFRSEDIIEHNLNIEKISFSPRIHRCGKPQHYIKLPKSLNEWKAIFYFAGV
MFGDGCVDRIANNDEEVFNKLKSLNNLGIEVERIKRKSSYEIIFKNGKNALINLLKILFD
YPSEKKSHNIKIPQILYIAPKELVAEFIKGYFDADGYVNLRQNRIEVISASKEFIEGLSI
LLLRFEITSKIYEIKKSYKETKKKYYQLNIVGKRNLKNFKNIGFSIKYKEENLNKIIEKS
RKSEKYPINKDMKRLRILFGMTRNEVNVSYYAKYENGKEIPSYEIVKKFLNSLKPKNLDK
KIKVLEGKERDVNYLKAFESDGLIENGRLTKLGREALNIWKNHEFGKENIDYMKSLIENI
AFVEVEDVEIIDYDGYVYDLTTETHNFIANGIVVHNTTLLDKIRKTRVAKREAGGITQHI
GASEIPIDVIKRLCGDLLKMLKADLKIPGLLVIDTPGHEAFTSLRKRGGALADIAILVVD
INEGFKPQTVEAVNILRQCKTPFVVAANKIDLIPGWNSKEGPFILNFNEKNQHPNALTEF
EIRLYENIIKPLNELGFDADLYSRVQDVTKTVCIIPVSAVTGEGIPDLLMMVAGLAQKFL
EDRLKLNVEGYAKGTILEVKEEKGLGTTIDAIIYDGIAKRGDYLVVGLPDDVLVTRVKAL
LKPKPLDEMRDPRDKFKPVNEVTAAAGVKIAAPELDKVIAGCPIRIVPKDKIEEAKEEVM
KEVEEAKIEVDDEGILIKADTLGSLEALANELRKAGVKIKKAEVGDVTKKDVIEVASYKQ
SNPLHGAIVAFNVKILPEAQKEIEKYDIKVFLDNIIYKLVEDFTEWIKKEEERIKYGEFE
KLIKPAIIRILPDCIFRQKDPAICGVEVLCGTLRVGAPLMREDGMQLGYVREIKDRGENV
KEAKAGKAVSIAIDGRVVLKRHVDEGDYMYVAVPESHVRELYHKYMDRLRNDEKEALLRY
MELMQKLTNNIFWGR
NT seq 3468 nt   +upstreamnt  +downstreamnt
atggctaaaaaaaacactaagaaggataataaaaatcagaatctcagatgtccaattgtg
tgtgttttaggacacgttgaccatggaaagtgcttaatgcctcatgagaaagttttaact
gagtatggagagattaagattgaggacttatttaaaataggaaaagagattgttgagaaa
gatgagttaaaagaaataagaaagttgaatataaaagttcatacactaaatgaaaatgga
gaaattaagataataaatgctccttatgtgtggaaactaaaacataaaggaaaaatgata
aaagttaagttaaagaattggcattcaataactacaacgccagaacatccattcttaacc
aataatggttggataaaagcagaaaatatcaaaaaaggaatgtatgttgcaataccaaga
aaaatttatggtaatgaggattttgagaagttcattgaatttattaattcaaagatatta
actaatgaattaattgtaaaagttaatgagaaagatttaaaaaacgtagagttgccttca
acaaaaatctacaaaaaacagaaaaatgttttcagaagcgaagatattattgaacataat
ctaaatattgaaaaaatatcattctctccaagaatccacagatgtggaaaacctcagcac
tatataaaacttccaaagtcgttgaatgaatggaaagctatattctactttgcaggagtt
atgtttggggatggatgtgtggatagaatagcaaataatgatgaagaagtattcaacaaa
ttaaaatcattgaataatttaggaattgaagttgagagaataaaaagaaaaagttcctat
gaaataatatttaaaaatggaaaaaatgcgttaattaatctccttaaaatattatttgat
tacccaagtgaaaagaaatcccataatataaaaatcccacaaatattatacatagctcca
aaagagcttgtagcagagtttattaaaggatactttgatgcagatgggtatgtaaattta
agacagaatagaattgaagtaataagtgcatcaaaggaatttattgaaggactttctatt
cttttattaagattcgaaataacatcaaaaatctatgaaattaaaaaatcttacaaagaa
actaaaaagaaatactaccaattaaacattgtaggaaagagaaacttaaagaacttcaaa
aacattgggttttcaataaaatataaagaagaaaacttaaacaaaatcattgaaaagagt
agaaaaagtgagaagtatccaataaataaagatatgaaaagattaagaattttgtttgga
atgacaaggaatgaagtaaatgtctcatactatgcaaaatatgaaaatggaaaagagatt
ccttcctatgaaattgttaagaaattcctaaattcattaaaaccaaagaacttagataaa
aagataaaagtattggaaggaaaagaaagagatgttaattatttaaaagcatttgaaagc
gatggtttaatagagaatggaagattaactaaattaggaagagaagcattaaatatttgg
aagaatcatgaatttggaaaagagaatattgactatatgaaatcattaatagaaaatatt
gcatttgttgaagttgaagatgttgaaattattgattatgatggctatgtgtatgattta
acaactgaaacacacaactttatagcaaatggtatagttgttcataacacaacactttta
gacaagattagaaaaacaagagtcgctaaaagagaagctggaggaattacccaacacata
ggagcaagtgagattccaatagatgtcataaaacggctgtgtggagatttattaaagatg
ctaaaagcagatttaaaaatccctggattgttggttatagacacccctgggcatgaggca
tttacctcattaagaaaaagaggaggagctttggctgatatagccatattagttgtagat
ataaacgagggctttaaaccacaaactgttgaggctgttaatatattaagacagtgcaaa
accccatttgttgtagcagcaaataaaattgacttaattcctggatggaactctaaggaa
gggccgtttatcttaaacttcaatgaaaaaaatcagcatccaaatgctttaactgaattt
gaaataaggttgtatgaaaacataataaaaccattaaatgagcttggttttgatgctgat
ttatactcaagagttcaagacgttacaaaaactgtctgtattattccagtatcagcagtt
actggagagggaattcctgatttattgatgatggttgctggattagcccaaaagttttta
gaggatagattaaagcttaatgttgaaggttatgcaaagggaacaatattagaagttaag
gaagaaaaaggattggggacaacgatagatgccataatttatgatgggattgctaagaga
ggagattatttagttgttggattgcctgatgatgttttagtgacaagagttaaagcttta
ttaaagccgaagccattagatgagatgagagacccaagagataaatttaagccagtaaat
gaagttactgccgctgcaggagttaagatagccgctcctgaattggataaagtcatagct
ggatgtccaataaggattgttccaaaagataagatagaggaagcaaaagaagaggttatg
aaagaagttgaagaggcaaagatagaggttgatgatgaaggaattttaataaaagcagat
actcttggttctttagaagctttagctaatgagttaaggaaggcaggagttaagattaag
aaggcagaggttggagatgtaactaagaaggatgttattgaagttgcatcatacaagcag
agtaatccattacatggagcaatagttgcctttaacgtaaaaattttaccagaagctcag
aaagaaattgaaaaatatgacataaaggtgtttttagataacattatctataagttggtt
gaggacttcacagagtggattaaaaaagaggaagagagaattaaatatggagagtttgaa
aaacttatcaagccagcaatcatcaggattttaccagattgtatattcagacagaaagac
cctgcaatttgtggagttgaagtcctctgtggaactttaagagttggagctcctttaatg
agggaggatggaatgcaattaggttatgttagggaaataaaagatagaggagaaaatgtt
aaagaggcaaaagcaggaaaggcagtttcaatagctatagatggaagagttgtattaaaa
aggcatgttgatgaaggggactatatgtatgtagctgttccagaaagtcatgttagagag
ctctaccataaatacatggataggttgagaaatgatgaaaaagaggcattgttaagatat
atggagttgatgcaaaagctaacaaacaacatattctggggaagataa

DBGET integrated database retrieval system