KEGG   Methanocaldococcus jannaschii: MJ_0299Help
Entry
MJ_0299           CDS       T00003                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mja  Methanocaldococcus jannaschii
Pathway
mja00010  Glycolysis / Gluconeogenesis
mja00030  Pentose phosphate pathway
mja00051  Fructose and mannose metabolism
mja00680  Methane metabolism
mja01100  Metabolic pathways
mja01110  Biosynthesis of secondary metabolites
mja01120  Microbial metabolism in diverse environments
mja01130  Biosynthesis of antibiotics
mja01200  Carbon metabolism
mja01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MJ_0299
   00030 Pentose phosphate pathway
    MJ_0299
   00051 Fructose and mannose metabolism
    MJ_0299
  Energy metabolism
   00680 Methane metabolism
    MJ_0299
Enzymes [BR:mja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MJ_0299
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MJ_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AAB98286
UniProt: Q57747
Position
complement(281755..282924)
Genome map
AA seq 389 aa AA seqDB search
MSRMENNKVTISVIKADVGGLCGHTLAPDELLEACEAVLEEAVDEIILDYYVTRCGDDID
LIMSHKLGCDNEKVHGLAWRAFEEATKVAKELKLYGAGQDLLADSFSGNVRGMGPGCAEM
EFVERKSEPIVVFCCDKTDPTAFNYPLFKMFADPFNTAGLVFDPSMISGFKFEVHDVVGH
KKVFLDTPEEMYMLLALIGDYEKYAIKRVYRRRDNEIAAVVSTEKLNYIAGEYVGKDDPV
AIVRAQSGFPAVGEVLEPFANPHFVPGWMRGSHWGPLMPVGEEDATPTRFDGPARIIALG
FQVCDGMLIGPNDLFADKGFDKAREKALEMADIIRRMGPFQPHRLPATMMEYTTVPKVLE
ALEDRFIPLEGLELIEEGGITRKDRGDVE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagaatggaaaacaacaaagtaacaatcagtgttataaaggcagatgttggaggt
ttatgtgggcacacattagctccagatgagttgttggaggcatgtgaggcagttttagag
gaggcagttgatgagattatattagattattatgtcacaagatgtggggatgacattgat
ttaattatgagccataaattaggttgtgataatgaaaaagtccatggattagcatggagg
gcttttgaggaggcaacaaaagtagctaaagagttaaagttatatggagctggacaggat
ttattagctgacagcttttcaggaaacgttagaggtatggggcctggttgtgcagagatg
gagtttgttgagagaaagagtgagccaatagttgttttctgttgcgacaaaacagaccca
acagcatttaactacccattattcaagatgtttgcagacccattcaacacagctggtttg
gtctttgacccatcaatgatttctggattcaaatttgaggttcatgatgtcgttggacac
aaaaaggtctttttagacactccagaagaaatgtatatgctcttagctttaattggagat
tatgagaagtatgcaattaagagagtttatagaagaagagataacgaaatagctgctgtt
gttagcacagaaaaattaaactacatagctggggagtacgttggtaaagatgacccagta
gctattgttagagctcagagcggattcccagcagttggagaggttttagagccatttgcc
aacccacacttcgttccaggatggatgagaggtagccattgggggccgttaatgccagtt
ggagaggaggatgcaacacctacaagattcgatgggccagcaagaattattgccttagga
ttccaagtttgtgatggaatgttaatcggtcctaacgatttgtttgcagataaaggattc
gataaagcaagagagaaagctttagagatggcagatattataagaagaatgggtccattc
caaccacacagattgcctgcaacaatgatggaatacacaacagttccaaaggtcttagag
gcattggaggatagatttattcctttagaaggtttagagttgattgaagaaggaggaatc
acaagaaaagacagaggagatgtggaataa

DBGET integrated database retrieval system